Skip to main content

Full text of "Wiener Zeitschrift für die Kunde des Morgenlandes"

See other formats


Wiener Zeitschrift für die Kunde des Morgenlandes. Bd. 16 1902 

Wien [etc.] Selbstverlag des Orientalischen Instituts, Universität Wien [etc.] 1887- 

http://hdl.handle.net/2027/coo.31924112770874 



TD 






■o 

Q- 
4+: 



rN ^ 



F P. 



u 

«4- ~° 

O <L> 

*S 

_ ■— 

'i/i öi 

> <U 

C CT 

=) O 

- o 

ä S 

£ -ö 

"ö 

■ö 
O 



03 



'c 



HathiTrust 




www.hathitrust.org 

Public Domain in the United States, 
Google-digitized 

http://www.hathitrust.0rg/access_use#pd-us-g00gle 



This work is deemed to be in the public domain in the 
United States of America. It may not be in the public 
domain in other countries. Copies are provided as a 
preservation service. Particularly outside of the United 
States, persons receiving copies should make appropriate 
efforts to determine the Copyright Status of the work 
in their country and use the work accordingly. It is possible 
that heirs or the estate of the authors of individual portions 
of the work, such as illustrations, assert Copyrights over 
these portions. Depending on the nature of subsequent 
use that is made, additional rights may need to be obtained 
independently of anything we can address. The digital 
images and OCR of this work were produced by Google, 
Inc. (indicated by a watermark on each page in the 
PageTurner). Google requests that the images and OCR 
not be re-hosted, redistributed or used commercially. 
The images are provided for educational, scholarly, 
non-commercial purposes. 



-0 _ 

(U o 

ü Q_ 



TD 



Ö. 


CÜ 


4-> 


cn 


_c 


o 




o 


^~ 


U) 


h- 


l/} 


z 


ZJ 


O 


■ö 

Q- 




CD 


lÖ 


i/) 


o 


=5 
I 


r\i 


l/) 


(N 




4 


U 


o 


U 




(T3 


rn 




i-H 

o 


s— 
O 



IN ,J 



!2 2 

F P. 



u 

«4- "O 

O <L> 

*S 

■h! ■— 

'i/i öi 

£ ? 

> <U 

C CT 

3 O 

- O 

.E -ö 

"ö 

■o 

O 



(ü 



-i-j 

'c 



0) o 
ü Q- 




TD 



ö. JL> 



Cl 



rN ,_; 



F P. 



CORNELL 

UNIVERSITY 

LIBRARY 




u 

O CL) 

*S 

■h! ■— 

'i/i öi 

> <U 

C CT 

=) O 

- o 

5 S 

.E -ö 

"ö 

■ö 
O 



03 



-i-j 

'c 

CD 



-ö b 
(U o 

ü Q_ 



lOO 



gle 



Original from 
CORNELL UNIVERSITY^ 



TD 



Q. 


CÜ 




cn 


_c 


o 




o 


--« 


U) 


h- 


l/} 


z 


ZJ 


O 


■ö 

Q- 




CD 


üS 


i/) 


o 


=5 
I 


fN 


l/} 


fN 




4 


U 


O 


u 




(ü 


PO 




i-H 
O 


s— 

o 



fM ,J 



F P. 



CORNELL UNIVERSITY UBRARY 




3 1924 112 770 874 



u 

O <L> 

*S 

■h! ■— 

'i/i öi 

> <U 

C CT 

=) O 

- o 

.E -ö 

"ö 

■o 

O 



03 



-i-j 

'c 

CD 



-ö b 
(U o 

ü Q_ 



lOO 



gle 



Original from 
CORNELL UNIVERSITY 



TD 



Q. 


CÜ 




cn 


_c 


o 




o 


--« 


U) 


h- 


l/} 


z 


ZJ 


O 


■ö 

Q- 




CD 


üS 


i/) 


o 


=5 
I 


(N 


l/} 


(N 




4 


U 


O 


u 




(ü 


PO 




i-H 
O 


s— 

o 



fM ,J 



F P. 



u 

O <L> 

'i/i öi 

> <U 

C Ol 



03 



O 
O 

ifl tn 

£ -o 
-ö £ 

E-e 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



ö. u 

.C o 



w I 

fN tO 

f\l ^ 

, O) 

i fU 



o o 



(T3 



$ 5 



WIENER ZEITSCHRIFT 



FÜR DIE 



KUNDE DES MOEGENLANDES. 



HERAUSGEGEBEN UND REDIGIRT 



J.KARABACEK, D.H.MÜLLER, L. REINISCH, L.v. SCHROEDER, 

c 

LEITERN DES ORIENTALISCHEN INSTITUTES DER UNIVERSITÄT 

TD 



XVI. BAND. 



WIEN, 1902. 0XF0KD 

ERNEST LEROUX, ALPKED HOLDER JAMES PARKER A Co. 



K. U. K. HOF- UND UNIYERSITÄTS-BUCHHÄNDLER 



LONDON TÜRIN NEW-YORK 

LU Z AC * Co- HERMANN LOESCHER, h ™?Z££^*"* 

BOMBAY 

u 

EDUCATION SOCIETY'S PRESS. 

'i/i öi 

> <U 

C CT 

Reprinted with the permission of the Orientalisches Institut 
der Universität Wien 

JOHNSON REPRINT CORPORATION JOHNSON REPRINT COMPANY LTD. 

111 Fifth Avenue, New York, N.Y. 10003 Berkeley Square House, London, W.l 

o c 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






■o 

Q- 
4+: 



.TU 






F P. 



u 

«4- "° 

O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 

C CT 

3 O 

— O 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 



First reprinting, 1966, Johnson Reprint Corporation 
Printed in the United States of America 



n 



V 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Inhalt des sechzehnten Bandes. 






(T3 



§ S 



Artikel. 

Seite 

Zum Mittelpersischen, von Th. Nöldeke 1 

Die Nachträge zu dem synonymischen Wörterbuch des Hemacandra, von 

Theodor Zachariae 13 

Bemerkungen zu Doughty's Travels in Arabia Deserta, von J. J. Hess . . 45 

Erklärung einer Veda-Stelle, von Julius von Negelein 63 

Zur Interpretation des Veda, von J. Kirste 71 

Critical Remarks on the Text of the Divyävadäna, von J. S. Speyer 103 

Einige arabische Ausrufe und Formeln, von Ignaz Goldziher 131 

Bänas Kädambari und die Geschichte vom König Sumanas in der Brihatkathä, 

von L. v. Manko wski 147 

TigrifSa-Texte im Dialekte von Tanben, von Enno Littmann 211 

Eine epische Idee im Veda, von Julius von Negelein 226 

LH wi 

Koptische Ostraka, von J. Krall 255 

Die Erzählung vom blauen Schakal in den Hamburger Paficatantra-Hand- 
o <-* 

Schriften, von Johannes Hertel 269 

«h E? 

Bemerkungen zur arabischen Trauerpoesie, von I. Goldziher 307 

Critical Remarks on the Text of the Divyävadäna, von J. S. Speyer . . 340 

Leo Reinisch 427 



Anzeigen. 

£ °- 

Georg Bühler, Gruudriss der Indo-Arischen Philologie und Alterthumskunde, 

fortgesetzt von F. Kielhorn, 1. Bd., 10. Heft. Litteratur und Sprache 

der Singhai esen, von Wilhelm Geiger. 
& ±± 

Wilhelm Geiger, Etymologie des Singhalesischen, von E. Müller .... 76 

M. A. Stein, Preliminary Report on a Journey of Archaeological and Topo- 

graphical Exploration in Chinese Turkestan, von L. v. Schroeder . . 89 

CO 
'(L) «fl 



Finnisch-ugrische Forschungen, Zeitschrift für finnisch-ugrische Sprach- und 



Volkskunde, nebst Anzeiger, unter Mitwirkung von Fachgenossen her- 
ld in 

ausgegeben von E. N. Setalä und Kaarle Krohn, von L. v. Schroeder 91 

11 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



IV Inhalt. 

Seite 

Dr. Karl Florenz, Japanische Mythologie, von L. v. Schroeder 92 

J. Takakusu, A Päli Chrestomathy, von M. Winternitz 94 

Carl Meinhof, Das T§i-venda', von K. Endemann 183 

Max Grünert, Ihn Kutaiba's Adab al-kätib, von R. Geyer 184 

J. Marquart, Eräniahr nach der Geographie des Ps. Moses Xorenac c i, von 

M. J. de Goeje 189 

Eberhard Schrader, Keilinschriftliche Bibliothek, von Bruno Meissner. . . 197 

J. Barth, Diwan des 'Umeir ibn Schujeim al-Qutämi, von Th. Nöldeke . . 275 
MunkAcsi Bernat, Arja 6s kaukäzusi elemek a finn-magyar nyelvekben, von 

H. SCHUCHARDT 286 

Silowan CHUNDADfE, Litterarisches Georgisch, von H. Schuchardt .... 362 

M. H. Adjarian, £tude sur la langue laze, von H. Schuchardt 379 

M. A. Stein, Kalhana's Räjataranginl, von M. Winternitz 405 

Kleine Mittheilungen. 

Zur Maiträyani Samhitä, von W. Caland 97 

Eine Einzelheit aus dem altindischen Familienleben in volkskundlicher Be- 
leuchtung, von Julius v. Negelein 100 

Ist das Nitisataka von Bhartrhari verfasst? von Johannes Hertel • . . . 202 

Pietro della Valle über das Nägari-Alphabet, von Th. Zachariae .... 205 

Die jBhartrhari^Strophen des Paflcatantra, von Johannes Hertel .... 298 

Armen, -k' als Pluralzeichen, von H. Schuchardt 304 

Etymologien und Berichtigungen, von Maximilian Bittner 305 

Georg. ?> £ = ts> > t§ '> von H - Schuchardt 420 

Erklärung 423 



I (ü 

O o 



CÜ 



F p. 



u 

O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 
C CT 
=) O 

— o 

CO 

£ -o 
-ö v 

E-e 

E => 

fD O) 



Original frorn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Zum Mittelpersischen. 

Von 

Th. Nöldeke. 

Durch die endlich erschienene Darstellung des ,Mittelpersischen', 
d. i. im Wesentlichen des Persischen der Säsänidenzeit, von Salemann 1 
ist der erste Theil des Grundrisses der iranischen Philologie würdig 
abgeschlossen. Dem Verfasser ist es gelungen, auf kleinem Raum 
eine reichhaltige und klare Uebersicht über die Sprache zu geben 
und dabei sehr viele Einzelfragen zu behandeln. Die Schwierigkeit 
der von ihm übernommenen und vorzüglich gelösten Aufgabe weiss 
jeder zu würdigen, der sich nur ein wenig mit dem Pehlevl be- 
schäftigt hat. Schon in den wenigen genau bekannten Säsänidischen 
Steininschriften werden die Laute durch die Schrift nur sehr unvoll- 
kommen ausgedrückt. Die Münzen und Gemmen ergeben ein ge- 
ringes Wortmaterial und zeigen zum Theil schon den Uebergang zu 
der ganz cursiven Bücherschrift, in der eine Menge Buchstaben ganz 
gleich geschrieben werden, etwa wie in der arabischen Schrift ohne 
diakritische Puncte; dazu kommen noch allerlei Entstellungen. Die 
starke Anwendung von Ideogrammen, d. h. von Wörtern, die semitisch 
geschrieben, aber iranisch auszusprechen sind, ist ein weiteres Hinder- 
niss, das allerdings nicht so arg ist, wie es anfangs erscheint. Die 
Ueberlieferung der Zoroastrier über die Aussprache, auch die durch 
diakritische Zeichen ausgedrückte, ist sehr unzuverlässig. Endlich ist 



T3 






■o 



(T3 



<=> o 



F P. 



> 

"c 

— o 



1 Grundriss der iranischen Philologie, herausgegeben von Wilh. Geiger und 
Ernst Kuhn. Bd. 1. Abtheilung 1 (Strassburg 1895—1901). S. 249 ff.: , Mittelpersisch' 
von C. Salemann. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 1 



fD O) 

in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



2 Th. Nöldeke. 

die Sprache der verschiedenen Pehlevl-Monumente nicht gleichartig. 
Buchstaben, welche in den alten Inschriften wohl noch wirklich den 
durch sie dargestellten Lauten entsprechen, werden im Buchpehlevl 
vielfach beibehalten, auch nachdem sich die Laute verändert haben, 
indem z. B. für ein aus t entstandenes d oder 8 doch noch t ge- 
schrieben wird. Wir können annehmen, dass das Phl. der späteren 
Säsäniden- und gar der muslimischen Zeit in der Hauptsache schon 
den neupersischen Lautbestand hatte, aber das Einzelne bleibt vielfach 
dunkel. Die Entwicklung des Mittelpersischen ist dazu nicht gleich- 
massig gewesen. Die Transcription der Nachbarvölker zeigt uns 
zum Theil schon in früher Zeit mehr oder weniger np. Formen und 
wiederum später noch alterthümliche. Und auch das Buchpehlevl 
selbst ist in der Behandlung der Laute nicht immer consequent so 
wenig wie das Np. 

Es erforderte also einigen Muth, eine Sprache zu beschreiben, 
von der Salbmann mit Recht sagt, dass es dem Forscher wohl für 
immer versagt bleiben werde, sich eine absolut sichere Anschauung 
von ihrem Bau zu bilden. Freilich gilt das auch von anderen todten 
Literatursprachen, aber doch von wenigen in dem Grade. 1 

Nachdem wir nun aber die treffliche Darstellung haben, darf 
es auch wohl ein Semitist, der sich mit dem Np. ziemlich viel, mit 
dem Phl. wenigstens dilettantisch beschäftigt hat, wagen, eine An- 
zahl Bemerkungen an jene anzuknüpfen. Die mittel- wie die np. 
Philologie bietet ja manche Berührungen mit der semitischen. Ich 
werde mit meinen Bemerkungen im Ganzen der Anordnung Sale- 






w I 

fN CO 

f\l ^ 

, O) 

o u 



o o 

c v> 
o E 



(T3 



mann's folgen, aber ohne mich streng an sie zu binden. 

Von den semitischen Ideogrammen (S. 251) wird rm nicht durch 



F P. 



farr, sondern durch das gleichbedeutende churah glossiert, aber auch, 
und das wird das eigentlich Richtige sein, durch ha%t* denn dies 



1 Allerdings wird es nach 1000 Jahren noch viel schwerer sein, eine einiger- 
massen richtige Vorstellung von den Lauten zu bekommen, welche die englische 
Sprache unter ihrer Orthographie versteckt, wenn nicht eine exacte phonetische 
Ueberlieferung erhalten bleiben sollte. 

2 Die betreffenden Stellen sind in Haug's Ausgabe des Glossars richtiger als 

in der Salemann's. 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Zum Mittelpersischen. 3 

Wort entspricht in seiner Bedeutung genau dem semitischen gadd 
~'jyjl- — Perfectformen wie jroinrun (nihäöan), jnaiirön (awgandan) 
gehören nicht der 3., sondern der 2. Pers. PL an. So auffallend die 
Wahl dieser zu Ideogrammen ist, die Thatsache steht fest. — Den 
ersten Buchstaben einiger weniger Imperfectformen, die Salemann i 
liest, lese ich : : z. B. jim-röra (aSnüdan) = pj?öu?D. Ein i wäre hier 
unerklärlich; das d ist das gerade in den aramäischen Dialecten, 
die mit den Iraniern am meisten in Beziehung waren, herrschende 
Präfix der 3. Pers. m. Es ist vielmehr auffallend, dass die meisten 
derartigen Formen mit dem westaramäischen •« gebildet sind, z. B. 
jnmT (büdan). 1 Auch sonst treten hier aber Formen aus verschiedenen 
aramäischen Dialecten auf wie ri3T (inschriftlich), y 2 , v neben rm. 
Einige dieser Formen sind ganz wunderlich, z. B. jniibruM (yurdan) 
für jnyirittft. Durchaus räthselhaft sind noch die Ideogramme pe (p«), 
nn (agar\ ona {abar). In dem schon auf den Inschriften vorkom- 
menden b'i (ö) finde ich immer noch die regelrechte Schreibung des 
semitischen bv, nicht ein persisches var (319), denn so gesetzmässig sich 
var später aus abar entwickelt, in altsäsänidischer Zeit ist die Form 
undenkbar. — Wie die Schreiber die Züge in den Ideogrammen 
mehrfach entstellt haben, so auch in *pK (ku), das in den Inschriften 
klar vorliegt, also nicht ein unmögliches jtk (292) ist. 

Die Erweichung eines b nach Vocalen zu v 8 entspräche ganz 
der des d zu §, aber ich bezweifle doch, dass Salemann jenen 
Vorgang mit Recht im Phl. annimmt, da das Np. da fast immer b 
beibehält. 4 Also würde ich lieber ab, äbädän u. s. w. lesen statt äv, 
ävädän (257). Durchaus unberechtigt erscheint mir hervad für S^j?* 



ti öi 



w i 

fN CO 

O u 



O o 

c v> 
o E 



F P. 



1 Auch der wie ein ? aussehende erste Buchstabe in solchen Formen ist nur 
ein verzogenes % z. B. |ru"6nr (kuätan) = pbtflp\ 

2 Die wie 3t aussehende Form ist nur graphisch aus y entstellt; wahrschein- 



u 

«4- ~° 

o aj 

lieh auch das scheinbare "p. 

8 Ich schreibe hier in iranischen Wörtern immer v, ohne zwischen dem 
Spiranten und dem Halbvocal zu unterscheiden, einfach weil ich in diesen Dingen 
nicht genügend Bescheid weiss. 

4 Ginge es im Lautwandel so nach dem Schema, so müsste auch g nach Vocalen 
immer zu y werden. 

1* 

E-e 

E => 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original from 






4 Th. Nöldbkb. 

(261). — Np. ist nicht lab (257), sondern lap (jüd. S]J Jes. 9, 19). 
Ob die ungewöhnliche Erhaltung der Tenuis durch ursprüngliche 
Verdopplung verursacht ist, weiss ich nicht. Dass das im Schahname 
öfters vorkommende läpp (z. B. 2, 785, 312) die ältere Form dar- 
stelle, hatte ich allerdings schon im ,Iran. Nationalepos' S. 68 (= 
Grundriss der iran. Phil. 2, 192) Anm. vermuthet. — Dagegen 
wird die Media ausschliesslich berechtigt sein in karg, ? Huhn' (267), 
vgl. Hörn zu Asadi 62; auch dialectisch so ZDMG. 32, 535; Shu- 
kowski 1, 194. 

In der m. E. sicher stehenden Form öämäsp (258) darf man 
keine wahre Ausnahme von der Regel sehn, dass anl. $ zu z werden 
muss, denn dieser Name war nicht volksthümlich. sondern wie andre 
seit dem 5. Jahrh. aus den heiligen Schriften oder der Helden- 
sage wieder ins Leben gerufen. 1 Dass Syrer und Griechen ihn mit 
T £ schreiben, beweist freilich auch nichts, denn sie drücken den 
ihrer Sprache fehlenden Laut § immer auf diese Weise aus. So 
lässt sich auch aus der arab. Form «3-^j 2 nichts darüber schliessen, 
ob die mp. Form mit j anlautet, denn dieser Laut fehlt dem 

c o 

Arabischen und musste durch j ersetzt werden. — Ob Hörn 
^^4" richtig zu sskr. yas stellt, will ich nicht entscheiden; o^^J^ 

TT) hj 

dessen Bedeutung auch noch recht unklar ist, kann aber nicht wohl 
zu yas gehören (297): wir haben meines Wissens kein Beispiel für 
np. anl. j aus y. 

Dass %§ schon in den Inschriften zum Theil nur historische 
Schreibung für s sei (262), glaube ich nicht. Dem •»-in^nnse ent- 
spricht noch im Mandäischen nxiPDfcnKB, 3 wo also in einer jüngeren 
np. Aussprache päda%sahr doch noch das /£ erhalten ist. Anders 
steht es natürlich mit der (pseudohistorischen?) Schreibung nrcmmi 
für Zartust, ZarduSt (261), obwohl sie von den np. Dichtern als 

O <U - 

1 JS. meine Tabarl-Uebersetzung 147 Anm. 1. 

2 Die wirklich übliche Vocalisation war wohl zibaq. Die Grammatiker ver- 
langen ^^Jj, s. Kämil 458, 15 ; Gauharl ^y Durch das Hamza erhält das Wort 
nämlich ein 'regelrechtes vierradicaliges ^la. 

8 Mand. Gramm, xxxi. 
.E -0 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

fN CO 

, O) 

O u 



O o 

c v> 
o 5 



(T3 



$ 5 



Zum Mittelpersischen. 5 

C^A);j wiedergegeben wird. — Aul. hu scheint im Iranischen seit 
alten Zeiten in für uns kaum controlierbarer Weise bald beibehalten, 
bald zu yu geworden zu sein. So auch Xüzistän neben altpers. 
(H)uvga (d. i. Hüza) und dem durch die Syrer ausgedrückten Hüz 
(so, nicht H8väz 264), im Gentilicium Hüzäje. Das arab. Ahwäz kann 
kaum etwas Anderes als der Plural davon sein. — Die mp. Formen 
must, angust (262) mit s statt s scheinen unglaublich; sie beruhen 
wohl auf Schreibfehlern. 

Ob mp. noch handäm oder schon andäm gesprochen wurde, 
lässt sich durchs syr. haddäm nicht entscheiden (265), denn dies 
Wort ist mindestens ein halbes Jahrtausend vor den Säsäniden ins 
Aramäische aufgenommen worden (s. Dan. 2, 5. 3, 29). Da aber 
schon auf einer alten Gemme TiBtPOöK steht, 1 so hat man wohl mp. 
ambär, andäm, angäm zu sprechen. — Der Vorschlag des h ist in 
hast so wenig lautgesetzlich wie in hast (265); er ist dort nach 
Analogie von haft vorgetreten, wie das ausl. h in dah das in nuh 
herbeigeführt hat. Solche Einwirkungen eines Zahlwortes auf ein 
benachbartes kommen ja in verschiedenen Sprachen vor. 

Dass das Arabische die Lautverbindung mb nicht kenne 
(266), ist nicht richtig. Vielmehr wird im Arabischen (wie in manchen 
andern Sprachen) jedes unmittelbar vor b tretende n wie m ge- 
sprochen, aber die Schreibung behält das etymologische n bei. 
Danach schreibt man dann auch im Np. für den ursprünglichen 
Lautcomplex mb oft nb. Was die Beurtheilung der in jenem Absatz 
behandelten iranischen Laute betrifft, so stimme ich aber mit Sale- 
mann ganz überein. 

iimo wurde schon früh sälär ausgesprochen. Ich halte es 
neben dem uns im 10. und 11. Jahrhundert als Eigenname 2 begeg- 
nenden ß^ (oder^Uo?) für den einzigen regelrechten Abkömmling 
der durch die historische Schreibung repräsentierten Form und np. 



T3 






T3 



i fD 
O o 



(T3 



F P- 



u 

«4- ~° 

O <L> 



■h! ■— 

jbj-^> für eine junge Neubildung. 

3 O 

— O . 

1 Tabari-Uebers. 444. 

2 Eigentlich vielleicht Titel. — S. den Index zu Ibn Athlr. 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



6 Th. Nöldbkb. 

Frayädj np. faryäd von *frayäta abzuleiten (268), scheint mir 
schon den Lauten nach bedenklich. Dazu muss ich an der Meinung 
festhalten, dass die eigentliche Bedeutung des Wortes ,Geschrei' ist. 
So >\^,j* o^ -4 ^ jt ^-">j ? lasse mein Geschrei zum Himmel dringen' 
Rückert-Pertsch 350, 4; vgl. eb. 348 v. 1; t:pö TRnß ^schreit' hat 
noch die ganz moderne Uebersetzung Hiob 6, 5; o^*-^ ; >^ij*i oder 
j^a*^ Jl^i ist ,aufs (Hülfs-)Geschrei losgehn' ganz wie ßorjödetv; 
L ^y>\* J i = $orfi6oq. Noch in Fällen wie o^> ji r^ ^r^ j* >^ij*t Schahn. 
3, 1101, 627 lässt sich auskommen mit ,auf jedes (Hülfs-)Geschrei 
bereit (zu helfen)'. Es begreift sich nun aber leicht, dass solche 
Redensarten die Auffassung von 3l^i als ,Hülfe' begünstigten, und so 
finden wir denn schon im Schahn. und andern frühern Werken 
^^b ibji, C jXa*\?L ib^i, ^«^ ib^s, ,Hülfe erlangen, suchen, Hülfe- 
geber' 1 und schon phl. rvnKns ,hilft' Minoch. 2, 107. — Für >y*y* 
wäre np. >y^ sicher die einzig richtige Vocalisation (268). Die aus 
dem Inder Mir Chosrau (Vullers 2, 1246 b) belegte Form >} ^J* be- 
ruht auf falscher Etymologie. Das Wort gehörte eben nicht der 
lebendigen Sprache an, sondern war, wie manches andre, den Zoro- 
astriern entlehnt und wurde willkürlich als , Gelage' gebraucht; da 
kam man leicht zur Anknüpfung an ^». 

In welchem Umfang das Mp. anl. v bewahrt, zu b oder zu g 
werden lässt, wird sich schwer ganz feststellen lassen. Die np. Um- 
Wandlung in b hat im Mp. vielleicht noch gar nicht stattgefunden. 
Die Transcription durch aram. d, griech. ß beweist nichts, da jenes 
a auch spirantisches v ausdrücken kann, im Griechischen aber da- 
mals ß schon zu v geworden war, der Buchstabe somit für v wie 



T3 






w i 

fN CO 

O u 



o o 

c v> 
o E 



(T3 



2 5 



für b dienen musste. Umgekehrt konnten die Araber, die den 



F P. 



Spiranten v (unser deutsches w) nicht hatten, in dem Namen annoi, 
den sie schon im 6. Jahrhundert als Bistäm adoptierten, nur b als 

° N 

Anlaut verwenden, ohne dass sie ein wirkliches b gehört zu haben 



1 Aehnlich ist arab. £ »Lo, i£ i-o , Schreier 4 auch ,Helier' (das alles reichlich 



> cu 

C CT 
=) O 

— o 

CO 

zu belegen), r r-°^ » au ^ ^ as Geschrei eingehen' (vgl. meine Abhandlung ,Zur Gramm, 
des classischen Arabisch' 28) ist ,helfen 4 . 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Zum Mittelpersischen. 7 

brauchen. 1 Aber zu g ist wenigstens dialectisch im Mp. anl. v auch 
in Fällen geworden, wo das geschriebene Phl. v zeigt. So ist uns 
der Name GuhiHäzäd = Vahist-äzät schon für das 4. Jahrh. durch 
die syrischen Märtyreracten ganz sicher mehrfach bezeugt. Zu den 
vielen Jüngern Formen von Vr&ragna 2 gehört Topapavr^ bei Theodoret 
(5. Jahrh.) und pm: Bedjan, Acta Mart. 2 ; 539, 557 (für dasselbe 
Jahrh.); die mp. Schreibung ist aber jmmi. Vinäs haben die Araber 
als gunäh aufgenommen (schon um 560 bei Härith, Mo'allaqa v. 70 
und öfter im Koran); sie hatten also schon ganz np. gunäh gehört. 
Gurgän, wofür die Armenier, die ja öfter alterthümliche Formen 
wiedergeben, noch Wrkan haben, ist uns schon im 5. und 6. Jahrh. 
bezeugt durch Topya Priscus c. 33 (Dindorf p. 344); Top^ü Joh. Lydus 
4, 75; Procop. Bell. pers. 1, 3 f.; syr. jrm Julianos 183, 28. In dem 
phl. Tractat über die Städtegründungen (frühestens aus dem 8. Jahrh.) 
wird das Land janu geschrieben; diese Schreibung mag schon alt 
sein. Die Stadt Weh-Arta§lr in Kermän heisst arabisch Bardaslr 
oder jy&^y j-^>^ d. i. die Wiedergabe von Guäslr. Ebenso heisst 
das kermänische Vologesokerta tjZJSbrtj, >j^^$ (Jaq. 4, 939, 13) heute 
GuläSkerd ; auch diese Form reicht vielleicht in alte Zeit. Denselben 
Namen trägt ein Ort bei Merv Jaq. 4, 297. Und selbst von dem be- 
rühmten Veh-ArtaStr (= Seleucia am Tigris), jüdisch ■vithik *o ? syr. 
Tümn ira, Ttrmn n^, 3 sagt die auf authentischen Berichten aus der 
Umgebung des Heraklius beruhende Darstellung der Ereignisse des 
Jahres 628 bei Theophanes A M 6118, es heisse persisch ToueSea^p. 
Man darf wohl annehmen, dass Leute aus gewissen Landschaften 
(wie die Balutschen) schon damals durchgängig aus anl. v immer gu 
machten. 



w i 

fN CO 

O u 



O o 

c v> 
o E 



F P. 



i/i 



1 Heutzutage setzen die Araber für unser w (ital., franz. v) gerne c3; der 
Laut klingt für sie den Labialen ähnlicher als ihrem * (engl. w). Die Syrer 



setzen für pers. t; auch manchmal l, wie die Griechen ou. 

2 Tab.-Uebers. 46. 

8 Das Veh ist da in das bei aramäischen Ortsnamen sehr beliebte Be ,Haus' 
(so meist gesprochen, wenn auch noch Be& geschrieben) umgedeutet. Die Constanz 



dieser Schreibung seit dem 5. Jahrh. spricht am Ende doch dafür, dass diese Semiten 

hier schon ganz wie np. beh hörten. 

.E "o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



8 Th. Nöldekb. 

Die Syrer haben die alte Form Harev (269) nn immer fest- 
gehalten. Die syrischen Christen haben es also noch gehört, als sie 
in Choräsän Kirchen gründeten (etwa im 5. Jahrh.). 

Die hebr. und aram. Form Dana entspricht der np. ^^o auch 
in Bezug auf das spirantische y 1 (269 f.). 

Das sonst unbelegte sitäd ,Preis' kann ich an der Stelle Daqlql's 
3, 1526, 52.2 nicht anerkennen (271); der Dichter sagt einfach: 
,ging wieder zu seinem Vater hin, stand da*. Müssige Versfüllung, 
wie sie das letzte Wort bietet, kommt im Schahn. oft vor. Die älteste 
Hdschr. (im Brit. Mus.) hat }U-uolj. 

Ich möchte wissen, ob wenigstens im älteren Np. nicht noch, 
wie in jüdischen Schriften, das ,gnädig sein* u. s. w. bedeutende 
Verbum ^>yx*±£ lautete und ob die Aussprache c»y^^ ( 271 )? wenn sie 
überhaupt gebräuchlich war, nicht erst durch das heterogene, aber 
ihm in den Lauten und der Bedeutung nahe kommende &X*Ä ± t 
, schenken', verursacht worden ist. Ebenso vermuthe ich, dass die 
einzig richtige Aussprache UU-a war, entsprechend der phl. wie der 
jüdischen Schreibweise und der Etymologie aus hu -f- mänä(k); UUa 
ist dann durch o^*-* herbeigeführt, wenn anders das Wort nicht 
schon längst obsolet geworden war, als man irrthümlich l3U-i vor- 
schrieb (299). — Ich glaube, die Vocalisation ^'ß ist ursprünglich (259), 
da es im Phl. lan heisst (West, Gloss. 242) und eine, freilich unbelegte, 
Nebenform J^jJ ist. So wird denn auch Muwaffaq 38, 7 guzand voca- 
lisiert. Auf oSß (das durch das in einem neusyr. Dialect vorkommende 
'r 3 ^ 2 repräsentiert wird) führte wohl c*^ß ? beissen'. — Die Form, 
woraus np. dlgar entstanden, ist m. E. nicht dudlgar zu sprechen 
(269), sondern didigar, da die Schreibung nrm kein i enthält. Anl. 
dvi wird regelrecht zu di: stand nun das d zwischen zwei i, so 
konnte es leicht wegfallen. — Für den Namen ^j ist durch die 
Reime bei Daqiqi die Aussprache Zarer gesichert; freilich könnte 



w i 

fN CO 

O u 



O o 

c v> 
o E 



F P. 



1 D^np scheint weniger gut: s. Baer zu Daniel 3, 10; das syr. y steht sicher, 



O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 

B ° 

auch durch Barh. Gr. 1, 217, 21. 

2 Fables en langue chaldeenne vulgaire par Daoud Taveugle (Mossoul 1896), 

p. 40. 135. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Zum Mittelpersischen. 9 

darum Zarlr (272) doch das Richtige sein, denn für solche Namen 
hatten schon die alten Dichter keine sichere Tradition. Die gelb- 
färbende Pflanze ^j,j (zu >jj?) hat (nach vielen Reimen) t. — Für y ? 
5> nehme ich als ältere Aussprache im Np. tö, dö an (273). Ich bin 
auch nach wie vor der Ansicht, dass die np. Nomina auf ^— durch- 
weg ö hatten, entstanden aus mp. ök (277). Die Ueberlieferung der 
Lexika hat für diese Frage wenig Werth. — Die gewöhnliche Ne- 
gation lautet im Np. vor vocal. Anlaut wohl immer nay, nicht niy 
(312). — Ist das e in den (wohl modernen) jüdischen Formen des 
Präsens 2. sg. e, 1. pl. em (312) echt oder handelt es sich da nur um 
eine ungenaue Punctation? Es ist doch sehr unwahrscheinlich, dass 
da eine Vocalisation erhalten geblieben wäre, die schon das älteste 
Np. verändert hätte. — Für .£>">y£> = o^ (307) hätte ich gerne 
Belege. Bei dem Schwanken der Vocalquantität im Np. 7 die auf 

(L> 

einer gewissen Unbestimmtheit in der wirklichen Aussprache beruht 
haben wird, konnten Dichter in der Hinsicht allerdings manches 
wagen. Dahin gehört auch die Verkürzung des causativen an zu 
an (305) bei Verben, die sonst nicht in den Vers gegangen wären. 1 — 
Dass in biiKS (syr. \oi~o) durch das sskr. Bahllka langes ä , erwiesen' 
sei (270), ist kaum richtig; die indische Form mag ja ä bloss als 
Vrddhibildung haben. Natürlich kann ich andrerseits durchaus nicht 
sagen, wann hier das ursprüngliche ä zu a verkürzt worden ist, 
das in J^ vorliegt. » « ^ in der Singanfu-Inschrift könnte ja allen- 
falls noch langes ä haben. — Dass es eine np. Form kvm für kam 
? wenig' gebe (286), bezweifle ich. 

Vielleicht darf man einen ^-Umlaut wie in inoe <^^> lme c}»> 
uö ^o auch in KtDömö, einer im Syr. beliebten Form für neuö np. 
möbad, sehn, die durch Beibehaltung des p und t auf ziemlich alte 
Zeit hinweist; man könnte nämlich die im Buchphl. übliche Form 
ebenso gut nemo wie nsiKtt lesen und das h hier, wie auch sonst, aus 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



2 5 



£ äi 

— -M 



intervocalem g (y) entstanden sein lassen. Freilich hat auch Sale- 
mann's Meinung, dass naiKö nur ein alter graphischer Fehler für 

CO 
'(L) «fl 

1 S. ,Iran. Nationalepos' S. 60 (= Grundriss 2, 189) nr. 2. 

E => 

fD O) 

1 i Digilized by ^.OOglC C0RNELL UNIVERSITY 

ü Q_ 



Original fronn 



10 Th. Nöldbkb. 

rißttö zu sein scheine (260), viel für sich; es handelt sich ja nur um 
ein einziges Zäckchen. 

Np. säyagän (280) ist sicher eine Ableitung von xsäya&ya = 
Sähi, Sah, also ^königlich'; ausser den Stellen bei Vullers 398 a 
unter 2 und 3 s. Näsiri Chosrau, Sefernäme 22 ? 10 (^Uoli p = 
vi^i-o ß jKönigselle') ; Wis uRämln 58 paen. 339, 3 v.u. Die bei 
Vullers nicht belegte andre Form Sähagän wird gesichert durch 
das bekannte ^l^ÜJl £/* ,das königliche Merv' (im Gegensatz zum 
,Fluss-Merv' Marvi Röd 3^p\ ^o). Selbst in der Bedeutung ,gratis', 
die £>IL>15> in dem Verse bei Asadi 97 und bei Vullers l. c. nr. 5 
haben soll, Hesse es sich schwer von ^^xJoLä 7 können a ableiten. 

Die Abstractbildung auf tin (281) ist in einigen jüdischen 
Schriften noch ganz lebendig, s. Stades Ztschr. f. altt. Wiss. 1896, 
232 ff. Sonst dürfte die Endung im Np. überall zu i§ verkürzt worden 
sein, ausgenommen in dem zweisilbig gewordenen däSan (mehrmals 
Wis uRämln 103), syr. däsnä, wofür im Judenpersisch die Neubil- 
dung JOTH, |ü\"H Merx, Archiv (1869) 1, 402, 14; Stade's Ztschr. 
a. a. O. steht. 

In den persischen Kurznamen auf öi, ö 2 möchte ich nicht mit 
Salemann 27 9 regelrechte Nominalsuffixe finden. Denn solche Kose- 
formen auf ö und ähnlich finden sich in den verschiedensten Sprachen: 
wie in den iranischen Dialecten und im Neusyrischen, so z. B. im 
Deutschen, Griechischen und Amharischen. Es sind zunächst Er- 
zeugnisse des Kindermundes oder des sich diesem anpassenden 
Familiengebrauchs. Im heutigen Deutsch, das klangreiche Endungen 
vermeidet, wird so lieber i oder mehr e gebraucht (Heini, Heine, 



CÜ 



ö. 2> 



Q. 



O o 



> $ 



F p. 



Berne u. s. w.). 3 



1 Die Bedeutung ,geziemen 4 = ^^vob hat es bekanntlich erst später an- 
genommen. Rückert hat scharf joLib mit ,geht an*, 8a, Job nut »steht an* ^p^ 

wiedergegeben {ZJDMG. 10, 210). 
jfr ■ - 

2 Ich könnte meine Darstellung dieser Erscheinung (Sitzungsber. d. Wiener 



CÜ 



TD 



Akad. d. Wiss., phil.-hist. CL cxvi, 387 ff.) jetzt vielfach vermehren und berichtigen. 

8 Der Einfluss der kleinen Kinder auf die Umbildung der Sprachen ist m. E. 

noch viel mehr zu beachten, als bisher geschehen. Bei unsern Sprachen, die durch 

Litteratur und andre Ursachen eine feste Gestalt gewonnen haben, tritt er freilich 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Zum Mittelpersischbn. 11 

Darmesteter's Etymologie von zendän (np. zindän) (282) wird 
bestätigt durch das mandäische be$ zainä, das ebenfalls ,Kerker' 
bedeutet und dem persischen Worte nachgebildet ist. Auch J^*?.}, 
; ^ij (das ich früher mit Unrecht aus dem Aramäischen ableitete) 
wird hierher gehören; s. Hörn, Etym. nr. 527 und Fr. Müller bei 
Hübschmann, Pers. Studien S. 60. 

iKirwH (284) findet sich auch noch im Np. In dem alten Korän- 
commentar (Journ. R. As. Soc. 1894) ist j\y*?*> viel häufiger als das 
sonst übliche j\^> ; es kommt auch im Bachtiärnäme (cod. Leid.) 
und sonst vereinzelt vor. Es ist wohl eine Zusammensetzung mit j\$*- 

c f 

^gering, leicht' (,übel-leicht' = ^schwierig') und das bequemere j\$<&> 
erst daraus entstanden. 

Wie die durch das semitische riDK u. s. w. ausgedrückte Subjects- 
form für ; ich' zu lesen sei, mag zweifelhaft sein. War es, wie wahr- 
scheinlich, az 7 so war das gewiss nicht aus altpersischem adam ent- 
standen (290), sondern aus einer Form wie dem azSm des Aw. Das 
Phl. wie das Np. zeigt ja durchaus nicht bloss Formen, welche direct 
dem Altpersischen entstammen. Und dass im Phl. und Np. z je aus 
echtiranischem d (ß) geworden, ist durchaus nicht anzunehmen, j^ 
(284. 290) ist entstanden aus jl J^ 1 Muwaffaq 16, 9. 23, 3 v. u. 152, 
10. 210, 7, das bei ihm mit }^ (ohne jl) wechselt. So denn auch mj 
im Judenpersisch (und neusyrisch gid)] also ganz regelmässig aus 
yutä. Die wunderliche Schreibung des Buchphl., die wie rvv aus- 
sieht, wird doch, wie auch Salemann annimmt, nur eine Ver- 
schnörkelung von nv sein. So wird ja auch *|Kn ,, v für *]Nnv ^^^ ge- 
schrieben. 

2 I 

Dass die als Instrumentale dienenden Genitive der Personal- 
st p- 



T3 



V öl 



w I 

fN CO 

f\l ^ 

, O) 

° m 

m - 

r-H 

o 5 

c v> 

o 2 



u 

«4- "ö 

O <L> 



> <u 

=) o 

— o 



pronomina durch die semitischen Formen mit der Präposition b dar- 
gestellt werden, z. B. *b = man u. s. w. (290 u. s. w.), kommt wohl 
daher, dass auch im Aramäischen die Construction des Passivparticips 



(U ü 



nicht mehr stark hervor; die Lallwörter und die kindlichen Analogiebildungen 
werden da bald durch das Regelrechte ersetzt. 
1 So schon Hörn, Etym. nr. 418. 

E-e 

E => 

ft3 <D 

to _C 
in 4-/ 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






12 Th. Nöldeke. Zum Mittelpersischen. 

mit b oft die active ersetzt, z. B. qfil ll = np. man kuSt /von mir ist 
getödtet worden' für qetle& ,ich habe getödtet'. 1 

Erä , deswegen' (292), eräki, Irak ,weil* kommt in älteren np. 
Werken auch noch vor, z. B. im persischen Tabari und bei Näsiri 
Chosrau. In unseren Schahname-Texten habe ich es nicht mehr ge- 
funden; da herrscht azlra. Später wohl nur noch zerä. 

^ ,das heisst' (292) ist nicht iranisch, sondern arabisch J$\. 
In dem Substantiven angehängten e vor Relativsätzen sehe ich immer 
noch das Os>^ ,3b. Dass es auch an Plurale tritt, z. B. kasäne 
ki y spricht nicht dagegen, denn auch sonst kann man ja z. B. kasäne 
,einige Leute' sagen. Gegen die Auffassung als Demonstrativ spricht 
erstens die Suffigierung, da die Demonstrativa im Np. vor das Sub- 
stantiv treten, dann, dass e (wie in) auf das Nähere (dieser) weisen 
würde, während als Correlativa die aufs Fernere deutenden Demon- 
strativa (der, jener) zu dienen pflegen. 

Ob das mp. Verbum tö%& (tux§?) dem Aw. bloss entlehnt ist 
(298), weiss ich nicht, aber das np. Partie. tu%&ä ist sicher nicht echt 
np., sondern aus der zoroastrischen Kirchensprache genommen; die 
Belegstelle dafür ist von einem Zoroastrier. 

Bei %vap hätte (303) die jüdische Form %ufs (tdbi5 Jes. 56, 
10 u. s. w.) erwähnt werden können, die S. 260 und 262 weniger 
zweckmässig schlechtweg als np. bezeichnet wird. Die übliche np. 
Form ist übrigens wohl nur %uspad, nicht %usbad. 

Sehr dankenswerth ist die am Schluss gegebene alphabetisch 
geordnete Liste von Ideogrammen mit ihrer Aussprache in Päzend 
und Transscription sowie den np. Aequivalenten. Nur ist zu bedauern, 
dass Salemann nicht auch die Nomina in dies Verzeichniss auf- 
genommen hat. 

Da superflua non nocent, spreche ich dem Verfasser noch ein- 

o v 

mal ausdrücklich meinen Dank für sein bedeutendes Werk aus. 

Strassburg i. E. 

'^ ct 

— o 

1 In den neusyr. Dialecten des Ostens hat diese Passivconstruction die active 
völlig verdrängt. 

^ tn 
£ -o 
-0 v 

E-e 

E =3 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



* 



03 






(T3 



2 5 



F P. 



T3 






Die Nachträge zu dem synonymischen Wörterbuch 

des Hemacandra. 

Von 

Theodor Zachariae. 

In meiner Uebersicht über die lexicographische Litteratur der 
Inder (in Bühlers Grundriss i, Heft 3 B, Seite 32 f.) habe ich über 
die Nachträge zu dem synonymischen Wörterbuch des Hemacandra, 
vom Nighantuöesa abgesehn, nur einen kurzen Bericht liefern können, 
da mir die Texte in schlechten Ausgaben vorlagen, und da mir zu 
der Zeit, wo ich jene Uebersicht schrieb, handschriftliches Material 
nur in geringem Maasse zugänglich war. Und doch hätten die Nach- 
träge zum Abhidhänacintämani eine genaure Behandlung wohl ver- 
dient. Was ich früher versäumt habe, will ich jetzt nachholen. Ich 
benutze dazu hauptsächlich die folgenden Handschriften, die sämtlich 
aus der Bibliothek des Deccan College in Puna stammen: 

1. Sammlung von 1875 — 76 Nr. 772: der Öesasamgraha des 
Hemacandra; 7 Blätter; die ersten beiden Blätter fehlen. Am 
Schluss : samäptä ceyam catvärimSadadhikacatiirdaSaSatajinabha' 
vanavidhäpanasävadhänamänasairl Kumärapäladeva nrpadevapra- 
tibodhikäriSrl Hemacandrasüri viracita (?täf) sasesä Nämamälä. 

2. Sammlung von 1872 — 73 Nr. 191: der Commentar des 
Vallabhaga^i zum oesasaipgraha des Hemacandra; 39 Blätter. 

3. Sammlung von 1873 — 74 Nr. 285: der Öiloncha 1 des Jina- 
deva Muniävara mit dem Commentar des Vallabhagani ; 20 Blätter, 



w i 

fN CO 

f\l ^ 

, O) 

° m 

m - 

o 5 

c v> 

o E 






u 

O <L> 

N 



Eine andere Handschrift des Öiloficha ist verzeichnet bei Abaji Vishnu 



Kathavate, Report an the search for Skr. MSS., Bombay 1901, p. 21. 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






.C o 



w I 

fN tO 

, O) 

O u 



f 10 - 

O o 

c w 

o 5 



ru 



$ 5 



F P. 



14 Theodor Zachariae. 

von denen nur das letzte von einer älteren Hand geschrieben ist; 
Blatt 1 — 19 sind von einer späteren Hand ergänzt und daher bei 
Weitem nicht so correct wie Blatt 20. 

4. Sammlung von 1875—76 Nr. 773: die Öesasaipgrahanä- 
mamälä des Sädhukirti; 41 Blätter. Die sehr schön geschriebne 
Handschrift trägt das Datum Saipvat 1744 varse dvitlya äsädhasudi 
8 budhaväre. Die vorliegende Copie — pratir 1 iyam — des Werkes 
ist gefertigt von Amaranandanagapi, einem Schüler des Räjasunda- 
ragani. 

Die genannten Handschriften werden aufgeführt in dem unent- 
behrlichen Catalogue of the Collections of MSS. deposited in the 
Deccan College by Sridhar R. Bhandarkar, Bombay 1888, pp. 51. 
68. 118; die beiden ersten Handschriften und die letzte auch in 
Aufrechts Catalogus Catalogorum. 

Der Sesasaingraha des Hemacandra 



liegt gedruckt vor in der Ausgabe des Abhidhänacintämaiji von 
Böhtlingk und Ried (St. Petersburg 1847) S. 421 ff. und in dem 
Bombayer Abhidhänasaipgraha, Band n (1896), Nr. 7. Der Titel des 
etwas mehr als 200 äloka umfassenden Werkes lautet kurz Öesäh 
(so Böhtlingk a. a. 0.)> oder Sesasarpgraha, oder auch oesasaipgra- 
hasäroddhära. 2 Der Titel Abhidhänacintämanipariäista in der Bom- 
bayer Ausgabe ist ohne Zweifel erfunden. Bühler (Ueber das 
Leben des Jaina Mönches Hemacandra S. 33. 44. 82) nennt das 
Werk Sesäkhyä Nämamälä. Diese Bezeichnung ist dem ersten Verse 
des Werkes entnommen (siehe unten). 



1 prati = pratikrti, Copie: Weber, Verzeichniss n, 1135, n. 1. Der Ausdruck 
prati begegnet auch im Prabandhacintämani p. 99, 16 (prathamädarSaprati); 100, 11 
(mülaprati). Tawnet in seiner Uebersetzung des Prabandhacintämani p. 60, n. 3 
vergleicht Gujarätl und Marathi prata ,copy of a book'. 

* So z. B. in der HuLTZscifschen Handschrift Nr. 147 (siehe ZDMG. 40, 16), 

die sich jetzt in Oxford befindet und das Datum Samvat 1453 trägt. Nach dem 
<+i cd t , 

mir bekannten handschriftlichen Material ist der Sesasamgrahasäroddhära von dem 

Sesasamgraha nicht verschieden. Anders Aufhecht, QaL CaL i t pp. 662. 768. 

o c 

E => 

ro <V 

1 i Digilized by ^.OOglC C0RNELL UNIVERSITY 

ü Q_ 



Original fronn 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 15 

Die Öesäh sind entweder als selbständiges Werk in den Hand- 
schriften überliefert, oder sie finden sich in den Commentar zum 
Abhidhänacintämani, an den Stellen wohin sie gehören, eingefügt. 
Bühler lässt es dahingestellt sein, ob die Sesäh ursprünglich ein 
selbständiges Werk waren (a. a. O., S. 44). Ich möchte mit Böhtlingk 
(Vorwort zum Abhidhänacintämani S. vn) annehmen, dass die äesäh 
ein selbständiges Werk bilden. Ein solches Werk muss einen Ein- 
leitungsvers haben. Dass er in den beiden Ausgaben fehlt, liegt 
nur daran, dass der Text der Sesäh hier aus Handschriften des 
Commentares zum Abhidhänacintämani ausgezogen (uddhrta) ist. In 
den Handschriften des Sesasamgraha lautet der Einleitungsvers: 1 

pranipatyärhatafi siddkasänga£abdänu§äsanah \ 
Sesäkhyanämamäläyä nämäni pratanomy aham || 

Ueber die Quellen, die er für seinen Sesasaiiigraha excerpiert 
hat, hat sich Hemacandra nicht näher ausgesprochen. Waren es 
Quellen, die ihm erst nach dem Abschluss des Hauptwerkes, des Abhi- 
dhänacintämani, bekannt wurden, oder waren es dieselben Quellen, 
die er für das Hauptwerk benutzte? — Bühler hat mit Recht darauf 
aufmerksam gemacht, dass die Sesäkhyä Nämamälä in sehr auffälliger 
Weise mit der älteren Vaijayanti des Yädavaprakäsa übereinstimmt 
(a. a. O., S. 33 f. 82; vgl. Göttingische Gelehrte Anzeigen 1894, 
S. 822 f.). Dem gegenüber muss jedoch betont werden, dass Hema- 
candra sicher noch eine Reihe andrer, wie es scheint gänzlich ver- 
lorener, Quellen excerpiert hat. 

Hemacandra überliefert in seinem Werke eine grosse Anzahl 

von seltnen, 2 bis jetzt zu einem grossen Theile unbelegbaren Wörtern. 
E I 

- "r? 

F P. 



■o 






Q- 






1 Dieser — von Vallabhagani ausführlich commentierte — Vers ist bereits 
mitgetheilt worden z. B. von Weber, Verzeichniss n, 258, der auch bemerkt hat, 
dass das erste Heimstich mit dem ersten Hemistich des Abhidhänacintämani 
identisch ist. 



2 Hierher gehört z. B. das aus dem Werktitel Bharatakadvätriinsika bekannte 

*~ (L> 

Wort bharataka Vers 90 ed. Bomb. (Böhtlingk: bhaUäraka). Vgl. dazu Aufrecht, 



cu 

c 

Catal. MSS. Oxon. p. 155, ZDMG. 14, 576; Weber, Indische Streifen i, 245. (Bhat- 
tfäraka Hem. Sesäh 90 ed. Böhtlingk kann nicht richtig sein, weil das Wort bereits 
im Hauptwerk, Abhidh. 336, aufgeführt ist). 

-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



Original fronn 



CÜ 






16 Theodor Zachariab. 

Um so mehr ist es zu bedauern, dass noch keine brauchbare Aus- 
gabe des Werkes erschienen ist. Böhtlingks Ausgabe ist nichts 
weiter als ein Abdruck der Sesäh nach einer einzigen, recht fehler- 
haften Handschrift des Commentares zum Abhidhänacintämajii, nebst 
Angabe der Strophen und Zeilen dieses Werkes, wohin die einzelnen 
Ergänzungen gehören. Doch muss, im Hinblick auf die lückenhafte 
Bombay er Ausgabe, anerkannt werden, dass Böhtlingk die Sesäh 
fast vollständig gegeben hat. Es fehlt — abgesehn vom Einleitungs- 
verse, siehe oben — nur der erste Halbvers des Sesasaipgraha : 

nirväne syäc chltlbhävah Säntir naiicintyam antikah,. 

Die Bombayer Ausgabe ist fast fünfzig Jahre später als die 
Petersburger erschienen. Man sollte meinen, die Bombayer Heraus- 
geber, Papdit Sivadatta und Käälnätha, hätten im Stande sein müssen, 
die Sesäh einigermassen correct und vollständig zu geben. Das ist 
aber keineswegs der Fall. Zunächst fehlt ein Halbvers hinter v. 28 
(Böhtlingk), einer hinter 90 a ; zwei päda fehlen hinter dem Worte 
seva 195; nicht weniger als drei Halbverse sind hinter 143 a aus- 
gefallen. Auch die drei Halbverse, die am Schluss der Petersburger 
Ausgabe stehn, hätten gegeben werden sollen, obwohl der letzte äloka 
(iyanta iti), da er in den Handschriften mit yad ähuh 1 eingeleitet 
wird, dem Hemacandra eigentlich nicht gehört. Ferner vermisst man 
in der Bombayer Ausgabe ungern die Angabe der Stellen des Abhi- 
dhänacintämani, die die Sesäh zu ergänzen bestimmt sind. Endlich 
ist im Einzelnen Vieles verfehlt, wenn auch nicht geläugnet werden 
soll, dass die Bombayer Ausgabe, der Petersburger gegenüber, einen 
grossen Fortschritt bedeutet. In v. 44 ed. Bomb, werden als Beinamen 
des Siva bhürir eko daSottamah gegeben. Man lese ekädaiottamah 
(so richtig Böhtlingk). In v. 84 ed. Bomb, und Böhtlingk findet 
man candako lähalä als Namen eines bestimmten musikalischen In- 
strumentes aufgeführt. Man ziehe die beiden Wörter in eins, canda- 
kolahalä, zusammen, wie es Böhtlingk im Petersburger Wörterbuch 

— o 

unter candakolähalä gethan hat; vgl. auch Vaijayantl 146, 252, wo 



1 yad ahur uktavantah prancah.; Vallabhagani. 

E => 

ro <V 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

fN «/) 

f\l ^ 

, O) 

O o 

c v> 

o E 



F p. 






w i 

fN CO 

o y 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 17 

Oppert die richtige Lesung gibt. Unter den Wörtern für ,Wind' 
v. 169 ed. Bomb, liest man Sucir vahälo naghatah. Die Wörter va- 
häla und naghata (Varianten: laghanta, laghata) sind neu. Die richtige 
Lesung ist vaho lolaghantah; 1 vgl. schon Böhtlingk v. 170: baho 
lolaghatah. 

Aus dem Vorstehenden ergibt sich, dass auch die Bombayer 
Ausgabe unsren Anforderungen in keiner Weise genügen kann. 
Eine zuverlässige Ausgabe der Sesäh ist ein dringendes Bedürfniss. 
Ausserdem sollten alle Wörter, die Hemacandra überliefert, auch 
wenn sie sich nicht belegen lassen, in unsere Sanskritwörterbücher 
aufgenommen werden. Böhtlingk hat allerdings, soweit ich sehe, 
die meisten besä -Wörter in den Petersburger Wörterbüchern ver- 
zeichnet: aber viele erscheinen hier in ganz falscher Form 2 — was 
bei dem Zustand der Handschrift, die er benutzte, nicht zu ver- 
wundern ist. Eine ganze Anzahl von Wörtern und Bedeutungen, die 
Hemacandra thatsächlich überliefert, würden bei Böhtlingk auch 
dann fehlen, wenn er alle Sesa -Wörter, die er in seiner Hand- 
schrift vorfand, in seinen Wörterbüchern aufgeführt hätte. Kirste 
hat in dem Index zu seiner Ausgabe des Unädiganasütra (1895) den 
neuen, d. h. den in Böhtlingks kürzerem Wörterbuche nicht ent- 
haltenen Wörtern ein Sternchen vorgesetzt. Bei einigen von diesen 
Wörtern sind die Sternchen insofern nicht ganz berechtigt, als die 
Wörter sämtlich in dem bereits 1847 herausgegebnen besasanigraha 



F P. 



des Hemacandra vorkommen und mithin in den Petersburger Wörter- 
büchern stehn sollten. Wenn sie bei Böhtlingk fehlen, so erklärt 
sich das aus der schlechten Beschaffenheit seiner Handschrift, 3 die 
ihm die richtigen Wortformen nicht immer darbot. Oder Böhtlingk 
hat richtige Wörter vermutlich aus dem Grunde nicht in seine Wörter- 
bücher aufgenommen, weil er die Formen für falsch hielt. Zuweilen 

o v 

*s 

1 lolä ghanfä asmät, hlaghantah; Vallabhagani. 

2 Aus 8neharekabhü bei Böhtlingk (PWB.) mache man zwei Wörter: snehu 
und ekabhü. Auch die Bombayer Ausgabe der Sesäh hat noch die falsche Lesart: 



1/? 



nur die Variante snedur ekabhuh kommt der richtigen Lesart ganz nahe. 

3 Vgl. Böhtlingk, Vorwort zur Ausgabe des Abhidhänacintämani S. x. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 2 

o c 

E => 

to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



18 Theodor Zachariae. 

handelt sichs auch nur um Eigentümlichkeiten der Orthographie. 
Die Wörter, die ich mir notiert habe, sind die folgenden: 1 

*idva1sara und *i4ävatsara (eine Art) Jahr, Hern. Un. 439 
(Commentar). Auch Sesasaipgraha 25 (idvatsara die Ausgaben). 
Vgl. Böhtlingk unter idävatsara und idvatsara. 

*uccilinga Granatbaum Uij. 105; auch Öesasaipgraha 126, wo 
beide Ausgaben fehlerhaft sind (ed. Bomb, fast richtig uccalinga), 
und wo die Bedeutung des Wortes allerdings abweicht; siehe Böht- 
lingk unter kücchalinga. 

*usas Nacht Un. 971: auch Sesasarpgraha 18, wo Böhtlingk 
<* 

umä, die ed. Bomb. uSä. Man lese u$äh. 

m 

*ekänasi ein Name der Stadt Ujjayani Un. 708; vgl. ekänasl 
ein Name der Göttin Durgä Sesasamgraha 55 ed. Bomb.; so auch 
Vallabhaga^i, der sich ausdrücklich auf Uiiädiganasütra 708 beruft. 
Dennoch könnte die von Böhtlingk gegebene Wortform ekänairisä 
die richtige Lesart sein. 

*ghasuri Feuer U$. 699; auch Öesasaipgraha 168, wo beide 
Ausgaben fehlerhaft. Die richtige Lesart steht in der Bombay er 
Ausgabe unterm Text (S. 6, Anm. 9). 

*corada 2 Dieb Uij. 171; auch Sesasamgraha 93, in beiden 
Ausgaben. 

*pattisa* eine Art Waffe Un. 579; auch Sesasamgraha 147 
(beide Ausgaben). 

*bharbhari Name der Laksmi Un. 9; Sesasaipgraha 76 (beide 






w I 

fN CO 

fN ^ 

, O) 

o y 



o E 



Ausgaben) 

- "r? 

F P. 



*mayuha Hitze Un. 51; vgl. mayuka Pfau Sesasamgraha 188 
ed. Bomb.; Böhtlingk: mayüka. Vallabhagani leitet mayuka von der 
Wurzel mi 9 praksepane { ab (minoty ahln mayukali) und beruft sich 
dabei auf Unädiganasütra 51. 



u 

«4- ~° 

O <L> 

N 



> <U 

=) O 

' o 



Ifl 



1 Den Sesasamgraha citiere ich immer nach der Ausgabe von Böhtlingk. 



2 Zur Bildung- des Wortes vgl. Pischel, Grammatik der Präkrit- Sprachen, §. 599. 

3 Zur Orthographie des Wortes vgl. GöU. Gel. Anzeigen 1898, 472. 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 
T3 






■o 






(T3 






Nachträge zu dem syn. Wörterbuch des Hemacandra. 19 

*vappa Vater Un. 296; auch Sesasamgraha 116 ed. Bomb. 
(Böhtlingk: väpya). Man vergleiche vapra, 1 das, nach den Lexico- 
graphen, auch , Vater c bedeuten soll. Einen Beleg — der ohne 
Zweifel aus der Maükhatlkä stammt — findet man im Commentar 
zum Anekärthasamgraha n, 442. 

*singhänaka 2 Rotz, Schleim Un. 71. Auch Sesasamgraha 105 ; 
nach Vallabhagani; die Ausgaben schreiben simhänaka. 

*hanusa ein Räksasa Un. 557. Auch Sesasamgraha 36 ed. 
Bomb.; Böhtlingk: danusa. 

Eine neue Ausgabe des Sesasamgraha wird sich, da selbst die 
ältesten mir bekannten Handschriften des Textes nicht frei von 
Fehlern sind, auf einen Commentar gründen und diesen Com- 
mentar vollständig zum Abdruck bringen müssen. Dass mehrere 
Commentare existieren, ist möglich; mir ist nur einer bekannt ge- 
worden, 

Der Commentar des Vallabhagani 3 zum oesasamgraha, 
Sesasamgrahatitä oder Sesasamgrahadipikä genannt ; verfasst im 



1 Es sei auch an bappa , Vater' erinnert, das auf Inschriften häufig* vor- 
kommt (z. B. bappabhatfärakapädabhakta Epigraphia Indica iv, 144, 1); vgl. Fleet, 
The meaning of bappä and bäva, Indian Antiquary xv, 272 ff. (Corpus Inscriptionum 
Indicarum in, 186 ff.). Fleet hat ganz übersehen, dass es einen Lexicographen 
gibt, der das Wort bappa mit der Bedeutung , Vater* überliefert. Hemacandra er- 
klärt in seiner zu wenig gekannten und zu wenig benutzten Deslnämamälä p. 213, 
3 ed. Pischel bappa mit , Soldat 4 , fügt aber hinzu, dass das Wort nach Anderen 
, Vater' bedeutet. Vgl. noch bäpo (v. 1. bappo) vidvän bäpaputropi vidvän der Vater 
ist gelehrt, der Sohn des Vaters ist auch gelehrt Prabandhacintämani 69, 10. 

2 Vgl. Pischel, Grammatik der Präkrit- Sprachen S. 185. 

3 Ich nenne den Commentator Vallabhagani im Anschluss an Goldstücker 
Dict. s. v. Abhidhänacintämani, an Bhandarkar, Report für 1883 — 84 S. 126, und 

an Aufrecht Cat. CaL i, 555. Bei Aufrecht heisst er auch Vädisrlvallabha und 

o v 



Srlvallabha (1. c, p. 562. 674). Diese drei Namen sind Bezeichnungen ein und der- 
selben Person und müssen daher bei Aufrecht zu einem einzigen Artikel vereinigt 
werden. Srlvallabha ,der Günstling der Glücksgöttin 4 ist ohne Zweifel der 
eigentliche Name unseres Commentators. Vgl. besonders sriSrivallabhavacaka in 
dem fünften Vers am Schluss des Durgapadaprabodha bei Weber, Verz. n, 251 und 
in dem zweiten Einleitungsvers zum Saroddhara bei Bhandarkar, Rep. für 1883 — 84 

S. 438. 

2* 

ft3 <D 

in 4-/ 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



20 Theodor Zachariae. 

Jahre 1 Saijivat 1654 = A. D. 1598 in der Stadt Vikramapura 2 
unter der Regierung des Fürsten Räjasiiiiha. 3 Diese genauen An- 
gaben finden sich in einer aus 28 Versen bestehnden Praäasti, 
die Vallabhagani seinem Commentare angefügt hat. Von weiteren 
Mitteilungen aus dieser PraSasti kann ich hier absehn. Die Namen/ 
die Vallabhagani nennt, und die Thatsachen, die er anführt, sind 
fast alle bereits bekannt aus seiner Praäasti zum Säroddhära, 5 aus 

1 In Worten: Satänandamukha (4) indriya (5) Uaputränana (6) abja (1). Zur 
selben Zeit — und an demselben Orte (Vikramanagara) — schrieb JSanavima- 
lagani, der Lehrer des Vallabhagani, den Commentar zum Sabdabhedaprakäsa des 
Mahesvara: Kielhorn, Ind. Ant. xix, 39, Nr. 77. Auch die Commentare des Guna- 
vinaya und des Sumativijaya zum Raghuvamsa sind in Vikramanagara ent- 
standen: Notices of Skr. MSS. ix, 152 f.; Raghuvamsa ed. G. R. Nandargikar, 
Bombay 1891, Preface, p. 12. 

2 kre^he pure Vikramanämadheye. Unter Vikramapura istBikanerzu ver- 
stehn (so schon Peterson, Second Report, p. 65), wo ein Rajasimha von 1573 — 1631 
regierte: siehe Prinsep, Useful Tables ed. Thomas p. 259, und Tod bei Weber, Verz. n, 
1207 (Zusatz zu S. 268). — Ist Vikra mapura (°nagara u. s. w.) jemals s. v. a. Ujja- 
yini? An der einzigen Stelle, die Böhtlingk unter Vikramapattana = Ujjayini citiert 
(Hall, Contribution p. 71), ist unter der Stadt des Vikrama sicher Bikaner zu ver- 
stehn: denn der König Gajasimha von Vikramapattana, den Hall nennt, regierte zu 
der von Hall angegebenen Zeit (1774) in Bikaner; siehe Prinsep a. a. O. und vgl. 
auch Hall a. a. O., p. 202. Man berichtige danach die Angabe, dass Vikramapattana 
= Ujjayini ist, in den Notices of Skr. MSS. n, 250 und bei Aufrecht, Cat. Cat. i, 
502. — Vikramapura ist nicht der ständige Wohnort des Vallabhagani gewesen. 
Seinen Commentar (Durgapadaprabodha) zum Linganusasana des Hemacandra schrieb 

1 CO 

er in Yodhapura unter der Regierung des Süryasimha im Jahre 1605, den Com- 

o 

mentar (Saroddhara) zum Abhidhanacintamani ebendaselbst im Jahre 1611; s. Weber, 
Verzeichniss u, 250 f. und Bhandarkar, Report für 1883 — 84, p. 126. 

8 Srivik?-amava7pJodbhavoxadvikramaräjasimhanrparäjye. Wörtlich dieselbe An- 
gabe (man setze nur nrpa für nrpati ein) in Vers 15 der Prasasti des Gunavinaya 

°~ i — 

zu seiner Damayanticamputlka, bei Bhandarkar, Report für 1883—84, p. 451. Die 

Worte bedeuten aber sicher nicht ,while Vikramaräja of the family of Vikrama 

was king*, wie bei Bhandarkar p. 143 übersetzt ist. — Ueber Rajasimha (Räl 



CÜ 



F P- 



U 



fc T, 



Singh), der ein General in der Armee des Grossmoguls Akbar und mit diesem 
auch verschwägert war, sind wir namentlich aus muhammedanischen Quellen unter- 
richtet; vgl. z. B. Aln I Akbarl, translated by Blochmann, i, 357 ff. Kurz über Ra- 
jasimha Malleson, An historical sketch of the native states of India (1875\ p. 112 — 13. 
4 Vallabhagani führt die folgenden geistlichen Oberhäupter des Kharatara- 

gaccha auf: Abhayadeva; Jinahamsa, Jinamänikya, Jinacandra, Jinasimha, Jinaräja. 

^ tn 

£ -o 
-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



5 Mitgeteilt von Bhandarkar, Report für 1883—84, S. 438 f.; vgl. S. 126. 



Original fronn 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 21 

der Prasasti (svakiyagurupattävall) des Jnänavimalagajii zur 6abda- 
prabhedatikä, 1 sowie aus verschiednen anderen Quellen. 2 Die Pra- 
sasti zur besasaipgrahatikä und die eben genannte Prasasti des Jnä- 
navimala — der der Lehrer des Vallabhagani ist — sind besonders 
nahe verwandt; sie stimmen sogar in einzelnen Ausdrücken fast 
ganz miteinander überein. 8 Vermutlich haben wir in den beiden 
Prasasti eine gemeinsame Arbeit des Jnänavimala und seines Schülers 
Vallabhagani zu sehen. 

Der Commentar des Vallabhagani ist nicht viel mehr als 300 
Jahre alt, ja er steht unsrer Zeit näher als der des Hemacandra. 
Es kann daher zweifelhaft erscheinen, ob dem Commentator so gute, 
alte Handschriften vorgelegen haben, dass er eine brauchbare Arbeit 
liefern konnte. Bis aber alte Palmblatthandschriften des Sesasam- 
graha, oder die Quellen, die Hemacandra excerpierte, bekannt ge- 
worden sind, werden wir uns auf die Arbeit des Vallabhagani ver- 
lassen müssen und, wie ich glaube, auch verlassen können. Mit 
peinlicher Genauigkeit erklärt er jedes einzelne Wort unter Berufung 
auf die grammatischen Werke des Hemacandra (Haimavyäkaranoiiä- 
didhätupäräyahäni). Er erwähnt öfters Varianten (päthäntara), wor- 
aus hervorgeht, dass er mehr als eine Handschrift des Textes be- 
nutzt hat. Einmal erwähnt er einen alten Codex, purätanüdarsa* 

1 Mitgeteilt von Peterson, Second Report, S. 126 ff. (vgl. S.* 65 f.) und von 
Webeb, Verzeichnis8 u, S. 266 ff. 

2 Vgl. z. B. die Pattävall in der Prasasti, die Bühler, Epigraphia Indica i, 
319 ff., herausgegeben hat. Diese Prasasti enthält zwei Daten: Montag, d. 11. No- 
vember 1594, und Donnerstag, d. 13. Mai 1596 (Kielhorn, Indian Antiquarg xx, 141). 
Die Abfassung der inschriftlich erhaltenen Prasasti ist nur durch eine kurze Spanne 

2 I 



TD 



Q. O) 



w i 

fN «/) 

N O) 
U 
U 

ro 



ro 

F P. 



u 



N 



Zeit von der Abfassung der Sesasarngrahatlkä getrennt. 

8 Auch Vers 1 — 4 der Prasasti zur Damayantlearapfitikä des Gunqvinaya 
(Bhandarkab, Report für 1883—84, S. 450 f.) und Vers 1—4 der Prasasti zur Sesa- 



sarngrahatlkä sind fast gleichlautend. 



4 Vallabhagani zu vaisakhe tüccharah (Sesasaingraha 22 Böhtlingk, wo nht- 



yasniin sa uccharah \ kutracit purätanadarie ca ucchiras tatredam vyakhyanam \ uccaih 



-5 1 

tharah): vaiiakhl paurnamäsy asya vaiSäkhas tatra \ ucchritäni Saräni Saraka(avanäni 

B ° 

tirosya ucchiräh \ brahmasabhäyäm mürtimattvän mäsänäm üi. Das fragliche Wort 

lautet in der ed. Bomb.: utsara; ebenso in dem Lexicon des Demetrios Galanos 

(nach Böhtlingk). In der Vaijayanti lautet es ucchuna: siehe Gott. Gel. Anz. 1894, 820, n 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



22 Theodor Zachariae. 

Die Werke und Schriftsteller, auf die sich Vallabhagani in 
seinem Commentar beruft, sind die folgenden: 

Ajaya, Amara, Amarapkä, Indu, Kavikalpadrumadhätupätha, 
Kslrasväniin, Khandiakhädyaka (°vädyaka MS.), Gitä, Gaudla ? Durga, 
die Nairuktäh, verschiedene Puräna (beim Namen werden genannt: 
Näradlya, 1 Padmapuräna, Bhägavata, Märkan<Jeya, Visnupuräna), 
Bhäguri, Bhärata, Bhärgava(?) ? die Brhadvrtti zum Siddhahemacan- 
dravyäkarana, Bhoja, Maftkha, Mann, Mahesvara (Visvakosa), Mala, 
Vanamälä, Varähamihira, Väcaspati, Vaijayantl, Vaijayantlkära, Vyädi, 2 
Sripati, Haläyudha. 

Der Siloncha des Jinadeva Muniävara mit dem Commentar 

des Vallabhagani. 

r 

Der Siloiicha ist bis jetzt, meines Wissens, zweimal gedruckt 
worden: in der Ausgabe des Abhidhanacintämani von Räm Das Sen, 
Calcutta 1878, S. 219 ff., ohne Nennung des Verfassers (,ed. Calc.'), 
und im Abhidhänasamgraha, Nr. 11, Bombay, Nirnaya Sägara Press, 
1896 (,ed. Bomb/). 

Der Autor, Jinadeva, hat seinen Namen und das Datum der 
Abfassung seines Werkes in einem Schlussverse angegeben, der in 



CÜ 






o o 

c v> 
o E 



(T3 



1 Der Monat Karttika heisst sairin (Sesarpgraha 23), weil in diesem Monat 
Pflüge (üra) geschenkt werden; Vallabhagani: Kärttikamäse hi äaivaSäsane baltvar- 



w i 

fN CO 
, O) 

dayotritanam halanäm danam diyate; yad uktam Naradiyapurane: ekäntaropavasesu 



biräny aM.au pradäpayet \ savasträm käncanopetäm sayyäm cälamkrtäm Subhäm iti. 
(Der Ausdruck ekäntaropavasa begegnet auch Prabandhacintäinani 43, 16.) Ueber 
die Sitte, auf die Vallabhagani anspielt, habe ich nichts ausfindig machen können. 
Docli vgl. immerhin Bühler, ZDMG. 46, 78 = Epigr. Indica n, 265; Kern, Der 



Buddhismus und seine Geschichte in Indien n, 266 n.; 367. Ueber ein halapanktl 

F P- 



däna vgl. Hemädri i, 291 ff. (Auszug aus dem Bhavisyottarapuräna). 

2 Bei der Erklärung des Wortes puskara , Sonne* citiert Vallabhagani aus 
Vyäcli: Susumnädyäs ca nädyosya pusnanti satatam grdhän\ und gleich darauf bei 
der Erklärung von brahman , Sonne': Hubhedät punas tasya tiricyante ca rahnayah\ 
satäni dvädasa madhau trayodasaiva mädhave \ caturdaSa punar jyesthe nabhonabha- 
syayos tathä \ pancadaSaiva tv äsädhe sodaSaiva tathäsvine \ kärttikike tv ekädasa ia- 
tany evam tapasy api \ marge tu daSa sardhani satany evam ca phalgune \ pausa eva 



param masi sahasram kirana raveh. Diese Citate beweisen, dass das Lexicon des 
Vyädi sehr ausführlich gewesen sein muss; vgl. Bühlers Grundrisse 3 B, Seite 7. 



w tn 

£ -o 
-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original from 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 23 

der ed. Calc. gänzlich fehlt und in der ed. Bomb, folgendermassen 

lautet: 

Vaikrame 'bde trivasvindumitef?) rädhädyapaksatau \ 

grantho *yam dadfbhe Srimajjinadevamunisvarah \\ 

Im vierten päda schreibe man Jinadevamunisvaraih und das 
Datum andre man um in triviivendra (tri = 3, visva = 3, indra = 
14). Der Siloncha ist demnach im Vikramajahre 1433 — A. D. 1376 
— 77 abgefasst. 

Es fragt sich jetzt: mit welchem von den verschiednen Trägern 
des Namens Jinadeva, die Klatt in seinem Jaina-Onomasticon (1892) 
S. 23 aufführt, haben wir unsren Autor zu identificieren? ■ — Valla- 
bhagani im Commentar zum Öiloncha bezeichnet den Jinadeva als 
einen Schüler des Jinaprabha aus dem Vj'ddhetara-Kharataragaccha. 
Wenn wir annehmen dürfen, dass in diesem Gaccha-Namen vrddhe- 
tara ,vom alten verschieden' für laghu 1 gebraucht ist, so kann Val- 
labhagani nur den Jinadeva im Auge haben, der, nach Klatt, dem 
Laghu-Kharataragaccha angehört, zwischen Jinaprabha und Jina- 
meru steht und der dritte Nachfolger des Jinashyiha ist. Dieser Jina- 
sirpha gründete die Laghukharatarasäkhä im Jahre Samvat 1331 
(Klatt, Ind. Ant. xi, 249; Weber, Verzeichniss n, 1046). Die einzige 
Quelle, wo KlaVt den Jinadeva aus dem Laghukharataragaccha ge- 
funden hat, ist die Prasasti des Cäritravardhana zu seiner Raghu- 
vaipsafikä, in der Ausgabe des Raghuvani.4a von G. R. Nandargikar, 2 
Poona 1885, Preface, p. 4. Hier findet sich die folgende Liste von 
Lehrern mitgeteilt: Jinasimha, Jinaprabha, Jinadeva, Jinameru, 
Jinahita, Jinasarva, Jinacandra, Jinasamudra, Jinatilaka, Jinaräja. 
Das Datum, das Klatt für Jinadeva gibt (about Samvat 1385), scheint 
mir etwas zu hoch gegriffen zu sein. Nicht nur deshalb, weil der 
Siloncha des Jinadeva erst vom Samvat -Jahre 1433 datiert ist: schon 

N 

die Zeit des Jinaprabha, des Lehrers des Jinadeva, ist von Klatt 
nicht richtig angesetzt worden. Nach Onomasticon S. 12 (vgl. Ind. 



~o 






w i 

fN CO 

O u 



o o 

c v> 
o 2 



(T3 



= 1 

F P. 



Ö3 "? 

> <u 

=) o 

— o 



(U <fl 



1 Vgl. laghu jünger' bei Böhtlingk; z. B. in laghubhrätr. 

2 Ich benutze die zweite Auflage dieser Ausgabe, Bombay 1891. Vgl. daselbst 

Seite 11, Anmerkung. 

'-o v 

E-e 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



24 Theodor Zachariae. 

Ant. 23, 171) lebte und schrieb Jinaprabha, ein sehr fruchtbarer 
Schriftsteller/ zwischen Saipvat 2 1349 und 1369. Danach Peterson, 
Fourth Report (1894) p. xxxvn: His (Jinaprabha's) known dates ränge 
from Sarpvat 1349 to Saijivat 1369. Allein Peterson selbst hat diese 
Angabe bald darauf, Fifth Report (1896) p. xxn, richtig gestellt, 
ebenso auch Bühler in einer seiner letzten Arbeiten: A Legend of 
the Jaina Stüpa at Mathurä, Wien, 1897, S. 2 f. = Indian Antiquary 
27, 50 f. (vgl. daselbst auch 26, 194). Der Tlrthakalpa des Jina- 
prabha ist nach Bühler zwischen den Jahren Samvat 1384 und 1389 
abgefasst. Demgemäss muss Jinaprabha weiter hinabgerückt werden. 
Dasselbe, meine ich, wird auch von seinem Schüler Jinadeva und 
von dessen nächsten Nachfolgern zu gelten haben. 3 

Der Siloncha des Jinadeva umfasst 139 Verse. Der Stoff ist 
genau so angeordnet wie im Abhidhänacintämani ; der Siloncha ist 
mithin in sechs kän<Ja eingeteilt. Was den Inhalt des Werkchens 
betrifft, so hat sich Jinadeva darauf beschränkt, die Nachträge oder 
Zusätze in Hemacandras grossem Commentar zum Abhidhänacintä- 
mani in Verse zu bringen. 4 Diese Zusätze — die von den eigent- 
lichen, metrischen Sesäh verschieden sind und mit diesen nicht ver- 
wechselt werden dürfen — sind, mehr oder weniger vollständig, mit- 
geteilt in den Auszügen aus dem Commentar zum 'Abhidhänacintä- 












CÜ 



■o 



1 Die Nirnaya Sägara Press hat im Jahre 1900 angekündigt, dass der dritte 
Teil des Abhidhänasaipgrnha unter Anderem den bisher ganz unbekannten H ai mä- 
nekfirthasamgrahasesa (also ein Supplement zu dem homonymischen Wörter- 
buch des Hemacandra), verfasst von einem Jinaprabhasuri, enthalten wird. Ver- 
mutlich ist dieser Jinaprabha mit dem Lehrer des Jinadeva identisch. 

2 Oder Samvat 1363—69, nach Onomasticon S. 40. 



3 Für Jinadeva und dessen Nachfolger — von Jinameru bis Jinaraja — gibt 
Klatt die Daten Samvat 1385, 1405, 1425, 1445, 1465, 1485, 1505, 1525, d. h. er 
teilt einem jeden zwanzig Jahre zu. Es versteht sich wohl von selbst, dass diese 
Daten nur annähernd richtig sein können, was ja auch Klatt unter Jinadeva, Jina- 



candra und Jinatilaka ausdrücklich bemerkt (Onomasticon S. 23. 18. 21). 



4 Vallabhagani sagt bei der Erklärung des Titels Siloncha: Hlat unche, Sil- 



yate xilam kanisädikam hiHemacandi'äcäryakrtäbhidhänacintämaninämamälävrttijava- 
fitlätaxabdajätalaksanam, tasya unchunam cunfanani silonchah. (Beachte euntana und 



vgl. Haimadhatuparayana i, 204 p. 29, 1 Kirste.) 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 25 

mani in Böhtlingks Ausgabe dieses Werkes S. 289 ff. und im Abhi- 
dhänasamgraha Nr. vi, Bombay 1896. Wir finden z. B. bei Böhtlingk 
S. 329 f. unter Strophe 338 — 40 die Nachträge stanapo *pi y kslrapo 
"pi 7 yauvaniko 1 "pi, da§amlstha ity api. Daraus hat Jinadeva fol- 
genden Vers gemacht (Siloncha 21): 

stanamdhaye stanapas ca kslrapas cäbhidhlyate | 
tärunyam syäd yauvanikä dasamistho jarattarah || 

Die Verdienste also, die sich Jinadeva um die Sanskritlexico- 
graphie erworben hat, sind sehr gering, und seine Arbeit würde 
wahrscheinlich für uns ganz wertlos sein, wenn eine vollständige und 
zuverlässige Ausgabe der Abhidhänacintämanivrtti vorhanden w.ure. 
Da Letzteres nicht der Fall ist, so wird es gestattet sein, hier zwei 
von den Wörtern, die Jinadeva überliefert, herauszuheben : jhampäna 
und lumbi (lumbi). 

Das erste Wort wird im Siloncha Vers 65 (jhampänam yäpyayä- 
navat) als ein Synonym von yäpyayäna, Sänfte, aufgeführt. Valla- 
bhagani leitet jhampäna von der Wurzel jham , essen' mit dem Suffix 
äna (Hem. Un. 278) ab, wobei das p unerklärt bleibt. Ohne Zweifel 
gehört jhampäna zu der grossen Klasse von vulgären Wörtern, die 
ins Sanskrit eingedrungen sind; vgl. z. B. Temple, Indian Antiquary 
xi, 297 b . Bekannt ist jhampäna, in der Form jampäna } aus der 
25. Erzählung der Bharatakadvätrimsikä, vgl. das Verzeichniss 
der Oxforder Sanskrithandschriften S. 156 und Weber, Indische 
Streifen i, S. 250. Dass jhampäna die richtige Form des Wortes ist, 
hat bereits Aufrecht im Festgruss an Rudolf v. Roth (1893) S. 129 
bemerkt, der hinzufügt, dass das Wort so (jhampäna) im Commentar 
zum Abhidhänacintämani und von Räyamukuta im Commentar zum 
Amarakosa geschrieben werde. Was wir als selbstverständlich voraus 
setzen müssen, da die Abhidhänacintämanivrtti die Quelle des Siloncha 
ist, wird uns hier von Aufrecht bestätigt : Hemacandra hat jhampäna 
im Commentar zu Abhidh. 758 als ein Synonym von yäpyayäna (und 
sibikä) , Sänfte' verzeichnet. 






<=> o 



F P. 



> 

"c 

— o 

CO 

s s 

1 Lies yauvanikä. So richtig Abhidhänasaijigraha Nr. vi, p. 17, n. 9. 

'■5 v 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



546 Theodor Zachariae. 

Ich wende mich zu lumbi (lumbl). 

Das Wort lumbl ist, meines Wissens, zuerst im Saptasatakam 
des Häla (Leipzig 1881), Vers 322, aufgetaucht. In der Anmerkung 
zu der Stelle teilt Weber mit, dass ,das sonst unbekannte lumvt 
mit stavaka (Büschel) erklärt wird und meint, das Wort könne von 
der Wurzel lamb ,herabhangen', mit Trübung des a zu u, herkommen. 

Leumann im Glossar zum Aupapätika Sütra (Leipzig 1883) S. 139 
unter pindl sagt, dieses Wort solle einen ,dichten Strauss' bedeuten; 
es werde auch mit lumbl erklärt, ,was aber selbst unbekannt ist'. 

Hier will ich noch anführen, dass Konow neuerdings in seiner 
Ausgabe der Karpüramanjarl (1901) S. 201 lumbl unter den seltnen 
und pro vincieilen Wörtern, die Räjasekhara gebraucht, genannt hat. 
Ob gerade lumbl diese Auszeichnung verdient, muss ich dahingestellt 
sein lassen. 1 

Ich werde jetzt zeigen, dass lumbi 2 in Böhtlingks Ausgabe 
des Abhidhänacintämani, St. Petersburg 1847, enthalten ist — freilich 
in corrupter Gestalt. 

Hemacandra Abhidh. 1126 lehrt fünf Wörter mit der Bedeutung 
,Büschel, Blütenbüschel': gucche gutsastavakagutsakäh \ guluflchah 3 



TS 









a> «fl 



1 Dasselbe gilt von mehreren andren Wörtern, die Konow anführt; vgl. z. B. 

chotx meine Bemerkungen in Bezzenbergers Beiträgen x, 132 f. Ebendaselbst 

Seite 128 habe ich für das von Lanman (Karpüramanjarl p. 201) besprochene Wort 



zu rinchoU meine Bemerkungen in Bezzenbergers Beiträgen x, 132 f. Ebendaselbst 

^ O) 
^ u 

käläksarika einen Beleg aus der Viddhasälabhafijikä beigebracht. 

2 Zu dem Worte lumbikä im Petersburger Wörterbuch (auch Vaijayanti 147, 
270) bemerke ich, dass es im Sesasamgraha 87 ed. Bomb, und bei Vallabhagani 
lambikä lautet. Vgl. Hern. Dhätup. i, 766. 

3 Die Form dieses Wortes schwankt zwischen guluncha und guluccha. Die 
Bildung der Form guluncha wird von Hemacandra, Un. 126, gelehrt; guluccha 
steht im Commentar zu Hern. Ling. i, 2 S. 33 Franke; so auch Päiyalacchi 139 (aber 
v. 1. gulumcha). Die Form guluncha: Trik. n, 4, 5 ed. Bomb., Härävali 141 (ed. 
Bomb.) v. 1.; Hem. Deslnämamälä p. 103, 5 guluncho guficha iti sarrtskrtasamah; die 
hier erscheinende seltene Wortform guficha (für gucchd) auch Häla 533 v. 1. und 
Hem. Abhidh. 1126 ed. Bomb. (Böhtlingk: gaccha). Ueber das Schwanken zwischen 



> <u 

ii ch und cch in den genannten Wörtern vgl. Pathak, Indian Antiquary xi, 273, n 



der für pincha (statt piccha) eine seltsame Erklärung gibt, und Pischel, Grammatik 
der Präkrü* Sprachen §. 74 S. 67. Da ein Beleg für das seltne Wort guluccha, so- 
viel ich sehe, noch nicht gegeben worden ist, so bemerke ich, 'dass es bei dem 

o c 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Nachträge zu dem öyn. Wörterbuch des Hemacandra. 27 

(ed. Calc und ed. Bomb, wohl richtiger: gunche gucchastabakagutsa- 
käh). Im Commentar S. 392 Böhtlingk fügt er hinzu: gulunchulanchl 
api. Man verbessere gulunchulumbl und übersetze: auch gulunchu 
und lumbi bedeuten ,Büschel'. 

Die Verbesserung ist durchaus sicher: denn wir linden lumbi 
auch bei Jinadeva, Öiloncha 100 f. Die ed. Calc. liest hier: sta- 
valce punah \ vyalumvalumvau ; die ed. Bomb.: stabake punah \ gu- 
luiichalunchyau. 1 In der mir vorliegenden Handschrift der Siloncha- 
tikä sind vom Text nur die Worte stabake punah erhalten; der 
Commentar aber — der besser, als die besten Handschriften des 
Textes, geeignet ist die Frage nach der richtigen Form eines Wortes 
zu entscheiden — lautet: 2 

gudyate guluiichuh, kevayubhuranyvadhvaryvädaya iti upra- 
tyaye nipätyate (vgl. Hern. ILri. 126 und 746); lubu tubun ardane, 
lumbayati lumbih, svarebhya ir iti ih (Hern. Un. 606). Vgl. Haima- 
dhätupäräyana i, 369 und x, 111, wo, wie hier, lumbi nach Hern. Un. 
606 gebildet wird. 

Schliesslich sei noch erwähnt, dass auch Sädhuklrti in der 
noch zu besprechenden Sesasairigrahanämamälä für lumbi ein- 
tritt: gucche tu gulufichur lumbir ity api (iv, 13l). 

Das Wort lumbi gehört zu den Wörtern, bei denen Hemacandra 

in ^ 

schwankte, ob er sie für Sanskrit- oder Präkritwörter, für sogenannte 
deslsabdäs, halten und ausgeben, ob er sie in seine Sanskritwörter- 
bücher oder in sein Präkritwörterbuch, die Desinämamälä, aufnehmen 
sollte. Beispiele habe ich in meinen Beiträgen zur ind. Lex. S. 55 f. 
gegeben. Auch lumbi (lumbi) — sicherlich ein desisabda — erscheint 
nicht nur in dem Nachtrag zu Abhidh. 1126, wie gezeigt wurde, 

sondern auch Desln. vn, 28, wo das Wort zwei Bedeutungen, sta- 

|* 

Mahäkavi Magna, Sisup. xn, 37, vorkommt; vgl. auch Sahrdayalilä ii, 12: kusuma- 
guluccham stabakafy. 

1 Die Wortform guluncha kann hier unmöglich richtig sein, da Hemacandra 
Abhidh. 1126 diese Form bereits gelehrt hat. Das hätten die Bombay er Heraus- 
geber des Siloncha bedenken sollen. Richtig ist allein gulunchu Schol. Hem. Abhidh. 
1126 S. 392 Böhtlingk. 

>+i- CD 

2 Das Wort stabaka erklärt Vallabhagani im Anschluss an Hern. Un. 27. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



CÜ 






T3 
Q. 



28 Theodor Zachariae. 

baka ,Büschel' und lata ^Schlingpflanze', erhält. Als Autor gebraucht 
Hemacandra lumbi dementsprechend teils im Sanskrit, teils im Prä- 
krit: im Pariäistaparvan vm, 173. 174. 179, wie Böhtlingk 1 nach- 
gewiesen hat, und im Kumärapälacarita i, 21, wo der Commentar 
das Wort mit phalasamüha erklärt. 

Wenn Hemacandra lumbi im Sanskrit gebrauchte, so hat er 
darin, wenn ich nicht irre, einen Vorgänger gehabt. Böhtlingk, Sans- 
krit -Wörterbuch in kürzerer Fassung vn, 389, citiert ein Wort lambl 
,ein blühender Zweig' aus dem Haravijaya des Ratnäkara (surapä- 
dapalambamänalamblparäga, der Blütenstaub der blühenden Zweige, 
die von den Götterbäumen herabhängen, 5, 87). Bedenkt man nun, 
dass der Haravijaya, wenigstens ursprünglich, in yäradäschrift nieder- 
geschrieben war, und dass in dieser Schrift la und lu leicht ver- 
wechselt werden können; ferner, dass die Erklärung von lambl mit 
kusumamayl Säkhä in dem Commentar des Alaka sehr gut auch zu 
lumbi passt: so wird man mit mir geneigt sein, das sonst nicht vor- 
kommende lambl Haravijaya 5, 87 in lumbi zu verbessern. Man 
nehme auch keinen Anstand, dem Ratnäkara den Gebrauch eines 
desisabda zuzutrauen. Dieser Dichter hat sich nicht gescheut, eine 
ganze Reihe von desläabdäs, von präkritischen Bildungen über- 
haupt, 2 in seinem grossen Kävya zu verwenden. Vgl. Alaka zu Ha- 
ravijaya 27, 15. 



° £ 

1 lumbi ,Frucht', Wörterbuch in k. F., v, 231. So auch C appeller in 
seinem Sanskritwörterbuch. Richtiger übersetzt Jacobi in seiner Analyse des Pari- 



CÜ 



o E 



(T3 



CD 



> £ 



F p. 



'i/i ü 
CD ? 
> CD 



sistaparvan S. 54 mäkandalumbi Paris, viii, 173 (cfr. ämralumbt 179) mit ,cluster 
of mangoes'. 

2 Hier eine kleine Blumenlese. Ratnäkara gebraucht grhacandra Spiegel 
Haravijaya 35, 21 (vgl. Pischel in Bezzenb. Beitr. xm, 4); grah akallola = Rähu 15, 
32. 44, 66 (s. meine Beitr. z. ind. Lex., S. 68)5 cudull Feuerbrand 14, 60 v. 1., cu^ult 
39, 22 v. 1. (Hern. DeS. III, 15); jharanka Strohmann 17, 90 (Hern. DeS. in, 55); tälüra 
Strudel 22, 19. 30, 76. 34, 27 (Häla 37); mandlra = manthänadhnranakataka (°kutaka?) 



27, 15. 31, 48. 46, 26 (Hern. DeS. vi, 141, wo mandlra mit manthana und irnkhala 



erklärt wird; vgl. Schol. Hern. Abhidh. 1023, S. 384 Böhtlingk, wo mandlra für 

manjira zu lesen ist, und Hern. Sesäh 134 nüpure tu pädaHtl mandn-am pädanälikä) , 

rasäyu Biene 28, 30. 29, 14 {Hern. DeS. vn, 2 vgl. Hern. Un. 1, Coram.); runjita 

Gebrüll 38, 66. 40, 48. 43, 81 (Hern. Fräkr. iv, 57); rola Kampf 43, 120 (Hern. JDeS. 

£ -o 
-ö v 

E-e 

E => 

fD CD 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

CD ^ 

C _Q 

CD 3 

ü Q_ 



Original from 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 29 

Die beiden Ausgaben des Siloncha, die in Indien erschienen 
sind, und die ich oben genannt habe, sind sehr schlecht und fast 
unbrauchbar. Die ed. Calc. (1878) will ich mit Stillschweigen über- 
gehn. Die ed. Bomb. (1896) ist wohl die schlechteste Ausgabe irgend 
eines Lexicons, die mir je zu Gesicht gekommen ist, — noch viel 
schlechter als die ed. Bomb, des Anekärthasaipgraha (vgl. Göttin- 
gische Gelehrte Anzeigen 1898, S. 473 ff.). Allerdings haben die Bom- 
bayer Herausgeber nur eine, offenbar sehr fehlerhafte, Handschrift 
des Siloncha benutzt, und der Commentar des Vallabhagani ist ihnen 
unbekannt geblieben. Dennoch hätten sie mit Hülfe des Commen- 
tares zum Abhidhänacintämani gar manchen Fehler ihrer Handschrift 
leicht und sicher verbessern können. Wie aus den übrigens spärlichen 
Anmerkungen in der ed. Bomb, hervorgeht, haben die Herausgeber 
zwar erkannt, dass Beziehungen zwischen Siloncha und Abhidhäna- 
cintämani (richtiger: Abhidhänacintämanivj'tti) bestehn, nicht aber, 
dass das Werkchen des Jinadeva nur eine Versificierung der Nach- 
träge oder Zusätze in Hemacandras grossem Commentar ist. Wer 
ein gutes Manuscript dieses Commentares besitzt, besitzt zugleich 
die Quelle des Jinadeva und ist im Stande, die Angaben dieses 
Lexicographen zu controlieren und die Fehler in einem Manuscript 
des Siloncha zu corrigieren. 

Soll der Siloncha für die Sanskritlexicographie nutzbar gemacht 
werden, so wird er zunächst neu herausgegeben werden müssen. In 
der ed. Bomb, erscheint nur der erste Kän(Ja in leidlich correcter 
Gestalt; in den übrigen Käncja ist fast jeder Päda durch einen oder 
auch mehrere zum Teil sehr grobe Fehler entstellt. Nicht antesad, 
sondern antisad (so richtig ed. Calc. !) lautet das Synonym von &isya y 
das Jinadeva, Siloncha 6 ed. Bomb., überliefert. Ich bemerke bei- 
läufig, dass antisad mit der Bedeutung , Schüler' in Jainaschriften 

o v 

nicht selten vorkommt; vgl. z. B. Weber, Verzeichniss n, 267, Vers 16. 






w i 

fN CO 

o y 



o 2 



(T3 



2 5 



_N 
'-I-J 
'Ol 

> <u 

C Ol 



i/) 



vii, 15); älunkhita berührt 18, 48. 20, 43. 43, 219, abhilunkhita =jvalita 17, 62 (vgl. 
Hern. Präkr. iv, 182. 208); vellahala zart 24, 45. 27, 53 (Hem. Bes. vn, 96, Weber zu 



Hala 599); samudragrhaka Badehaus 32, 4 (Pischel, Bezzenb, Beitr. vi, 101); 
svmbharana •= samsmarana 38,41 (Pischei,, Gramm, der Präkritsprachen, S. 217). 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



30 Theodor Zachariae. 

Nach Siloncha 15 ed. Bomb, ärdraiabdau Sriyäm matau sollten (die 
beiden Wörter) ärdra und Sabda die Bedeutung Sri haben. Man 
verbessere ä-i-Sabdau d. h. die beiden Wörter ä und l vgl. Schol. 
Hem. Abhidh. 226. 

Siloncha 61 lese man paribarhana für parivakarna (vgl. Schol. 
Hem. Abhidh. 716), 68 llyäm für Umyäm. 

Ueber karno päritre 78 (lies karno 'py aritre) habe ich bereits 
in dieser Zeitschrift xiv, 231 gesprochen. Ebenso falsch ist auch 
visphoto pitake 33, viskambho katako 'sya tu 90, märyo 1 puste 111. 

In dem Scholion zu Hem. Abhidh. 1369 (vgl. Abhidhänacintä- 
mani ed. Bomb. p. 52 n. 8) wird anindriya als ein Synonym von manas 
aufgeführt. Dementsprechend lese man Siloncha 125 mano 'nindriyam 

o 

api statt mano nendriyam api. Auch in der corrupten Stelle Unädiga- 
nasütra 952 p. 153, 2, wo manas erklärt wird, dürfte anindriyam zu 

tu 

lesen sein, nicht antarindriyam, wie Kirste (Notes, p. 180) vermutet. 

Wenn ich sagte, dass der Siloncha des Jinadeva fast wertlos 
sei, so gilt das nicht auch von der Silonchatlkä des Vallabha- 
gani. Da Vallabhagaiii jedes einzelne Wort des Textes, unter Be- 
rufung auf die grammatischen Werke des Hemacandra und andre 
Autoritäten, mit beispielloser Genauigkeit erklärt, so ist der Com- 
mentar für die Feststellung der Wortformen unentbehrlich. Eine 
neue Ausgabe des Siloncha, mit dem Commentar des Vallabha- 
gani, wäre erwünscht. 

Vallabhagani hat an seinen Commentar eine lange aus 28 Versen 
bestehnde Praäasti angehängt. Sie ist ihrem Inhalt nach, wie 
auch in einzelnen Ausdrücken, der oben besprochnen Praöasti zur 
Sesasamgrahatlkä überaus ähnlich. 2 Nur der Vers, worin das Datum 
der Silonchatlkä gegeben wird, sei hier ausgehoben: 



w i 

fN CO 

O u 






o E 



(T3 



2 5 



F P. 



1 Nach Vallabhagani ist zu lesen: mayur us(re\ vgl. Abhidh an asamgraha Nr. 6, 
p. 48, n. 2 (mayur ity ehe) und Hera. Un. 726, wo mayu ,Kameel' ebenfalls über- 
liefert ist. Aber Vallabhagani kennt auch die Form marya für mayu (oder maya, 
Abhidh. 1254). Diese Form marya finden wir im Scholion zu Abhidh. 1254, S. 400 
Böhtlingk: marya ity ehe. 

2 Die folgenden geistlichen Oberhäupter des Kharataragaccha nennt Vallabha- 
gani in der Prasasti zur Silonchatlkä: Abhayadeva, Jinavallabha, Jinadatta; Jina- 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 51 

vedendriyarasaprthvtsarrikhye varse Sunägapuranagare | 
madhumäsädye pakse mülärke saptamltithyäm || 21 || 

Danach hat Vallabhagani seinen Commentar Sonntag, den 19. 
März 1598 mit dem Naksatra Müla ; in der Stadt Sunägapura, 
vollendet. 1 

Ich gebe noch ein Verzeichniss der Werke und Schriftsteller, 
die Vallabhagani citiert: 

Amara, Amaratlkä, Arnika, Indu, Indravyäkarana, 2 Utpala, Kätya, 
Kautalya (? Grammatiker), Ksirasvämin, Gau<Ja ; Candra, Durga, 
Dramiläh, Dhanapäla, Dhanvantari, Nairuktäl?, Bharata, Bhäguri, 
Bhoja, Manu, Mala, Mäläkära, Muni, Yädava, Raksita (Durghate 
Raksitah), Väcaspati, Vämana, Vikramädityakoäa, Viäva, Vaijayantl, 
Vopälita, Vyä<Ji, 3 Säsvata, Südasästra, Haläyudha, Härävali, Hugga. 4 

Die Sesasaipgrahanämamälä des Sädhuklrti. 
Das Werk beginnt mit dem Verse 

samdhäya hfdi sarvajnam irlPärSvam gurubhäratlh \ 
Abhidhänacintämaneh, kurveham Sesasamgraham || 
Danach ist der Öesasaipgraha des Sädhuklrti eine Er- 
gänzung zu dem synonymischen Wörterbuch des Hemacandra und 
verdient daher hier kurz besprochen zu werden. 5 

mänikya, Jinacandra, Jinasiraha, Jinaräja (Nr. 42 — 44. 60 — 63 bei Klatt, Ind. 
Ant. xi, 245 ff.). 

1 Professor Kielhorn hat die Güte gehabt, das Datum für mich zu berechnen. 



TD 



V öl 



w I 

fN CO 

, O) 

° m 



o 2 



(T3 



Wegen mülärka verweist er mich auf Epigraphia Indica vi, p. 21, n. 5. 

2 Vallabhagani zu Siloflcha 60 Hanümän api Märutau citiert aus dem Indra- 
vyäkarana das Sütra kvacin matau dirghafy. Ueber das Indravyäkarana vgl. Kiel- 
horn, Ind. Ant, xv, 181 ff. 

8 Zu Siloficha^öS citiert Vallabhagani aus Vyädi: nyuhjdh khadgah kadatalam, 
mit dem Zusatz sa ca deSyäm api. Vgl. dazu Böhtlingk unter ka^ltala und kaditula; 
Mahävyutpatti 238, 23: kadintala\ Sädhuklrti, Sesasamgrahanämamälä in, 199: llyäm 
nyubjah khadgafy kadüalam tathä. Nach Hemacandra Des. n, 19 ist ka4alalä eine 
krumme, einschneidige, eiserne Waffe. 



> V 

4 Vgl. meinen Aufsatz über den indischen Lexicographen Hugga, WZKM. 

CO 



xiv, 225 ff. 

6 Einen genauen Bericht über das Werk des Sädhuklrti zu liefern bin ich 
nicht im Stande, da mehrere Blätter der Handschrift so fest zusammengeklebt sind, 

E-e 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



32 Theodor Zachariae. 

Das Werk ist, wie der Abhidhänacintämani, in sechs Abschnitte 
eingeteilt. Den breitesten Raum nehmen die Synonyma der Bäume, 
Sträucher u. s. w. ein, kurz die Wörter, die in ähnlicher Vollständig- 
keit sonst in den medicinisch-botanischen Specialwörterbüchern auf- 
geführt zu werden pflegen, und von denen Hemacandra selbst eine 
grosse Anzahl in seinem NighaijLtuöesa zusammengestellt hat. Das 
Werk des Sädhuklrti umfasst gegen 1500 äloka und ist somit beinahe 

so gross wie das Werk des Hemacandra, das es zu ergänzen be- 
i- 
stimmt ist. 

o 

Ueber seine Quellen äussert sich Sädhuklrti nicht. Es liegt 
aber auf der Hand, dass er in erster Linie den Sesasaipgraha des 
Hemacandra benutzt und verarbeitet hat. Auch andre Werke des 

6 

Hemacandra gehören offenbar zu seinen Quellen: so die Abhidhä- 
nacintamanivrtti, 1 der Anekärthasaipgraha, der Commentar zum Unä- 
digaiiasütra. 2 Ausserdem scheinen der Trikäncjaäesa und die 
Härävall von Sädhuklrti excerpiert worden zu sein. Ob eine 
mittelbare oder unmittelbare Benutzung dieser Wörterbücher statt- 
gefunden hat, lässt sich nicht feststellen. Andre Quellen, als die ge- 
iz ° 

nannten, vermag ich mit Sicherheit nicht zu erkennen. Dass Sädhu- 
klrti zu dem, was er bei seinen Vorgängern fand, eigne Zusätze 
gemacht hat, wird man ihm zutrauen dürfen. 

Ebensowenig wie über seine Quellen äussert sich Sädhuklrti 
über die Zeit, zu der er lebte und schrieb. Wenigstens fehlt eine 
Praäaati in der mir vorliegenden Handschrift des Sesasaipgraha. 
Dennoch lässt sich die Zeit des Sädhuklrti — vollständig: Vädlndra- 



(T3 



2 5 



F P. 



l 



dass es nicht möglich ist, sie von einander zu trennen, ohne Papier und Schrift 
wesentlich zu beschädigen. 

So geht Sesasamgrahanämamälä i, 5 sädhau tapodhano yogl Samabhrt ksän- 
timän api offenbar zurück auf Schol. Hem, Abhidh. 76, S. 296 Böhtlingk: tapodhano 

N _ 

yogl kamakft k#antimän ity adtni yavgikäni namani bhavanti. 

2 In einem Nachtrag zu Hem. Abhidh. 366 überliefert Sädhuklrti in, 4 das 
den älteren Kosa fremde Wort visamsthula genau in der Orthographie, die im Unä- 
diganasutra 487 vorausgesetzt wird (siehe O'öttingisclie Gelehrte Anzeigen 1898, S.467). 
Die Worte des Sädhuklrti lauten: vyagre vUamathuh binduyuktälavyah sa dant- 
yayuk. 
'■5 § 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






O o 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 33 

srl-Sädhukirtyupädhyäya 1 — ziemlich genau bestimmen. 2 Einer seiner 
Schüler, Sädhusundaragani, der Verfasser des Uktiratnäkara, Dhä- 
turatnäkara und Sabdaratnäkara, versetzt ihn in der Prasasti 3 zu 
dem zuerst genannten Werke an den Hof eines Fürsten der Yava- 
nas (yavanapatisabhä). Was für ein yavanapati gemeint ist, ergibt 
sich aus der PraSasti 4 zur Kriyäkalpalatä, 5 dem Commentare des 
Sädhusundara zu seinem Dhäturatnäkara. In Vers 16 teilt Sädhu- 
sundara mit, dass Sädhukirti vom Kaiser Akbar den ehrenden 
Titel Vädlndra (Fürst unter den Disputanten) — den Titel also, den 
er thatsächlich führt — erhalten habe (vädtndram birudam nfpäd Aka- 
baräl lebhe samam kovidaih). Sädhukirti gehört danach der zweiten 
Hälfte des 16., vielleicht auch noch dem ersten Viertel des folgenden 
Jahrhunderts, an. 

Aus dem reichen Inhalt der Sesasaingrahanämamälä will ich 
hier ein Wort herausheben, — ein Wort, das ich schon früher zu 
besprechen Gelegenheit gehabt habe: ogha. 

Hemacandra Anek. n, 574 ed. Calc. (vgl. 568 in meiner Aus- 
gäbe) schreibt dem Worte pavitra die Bedeutung arghopakarana zu. 
In meinen Beiträgen zur indischen Lexicographie S. 88 habe ich 
gezeigt, dass die richtige Lesung vielmehr oghopakarana ist, und 
dass der Commentator Mahendrasüri diesen Ausdruck folgender- 
massen erklärt : oghopakaranam ürnätantusamtatinirmitam Jaina- 
munlnärri rajoharanam d. h. das ogha (genannte) Geräthe 6 ist der 



* 



(T3 



l/) 



1 So nennt sich Sädhukirti in der Regel in der? Unterschriften der einzel- 
nen Kapitel. Ebenso wird er von seinem Schüler Sädhusundara genannt; vgl. z. B. 



Notices of Skr. MSS. vm, 11, Nr. 2557. 
iE ^ 

2 Siehe bereits Peterson, Fifth Report (Bombay, 1896), p. lxxviii f. 



3 



Mitgeteilt von Peterson, Fourth Report (Bombay, 1894), Extracts from 
MSS., p. 14. 

4 S. Peterson, Fifth Report, p. 157 ff. 

5 Verfasst (vollendet) Samvat 1680 Subhe dipalikädine. Ein Versehen ist es, 
wenn Jacobi ZDMG. 33, 697 die Abfassung des Dhäturatnäkara ins 18. Jahrhundert 
setzt. Leider ist diese Angabe von Aufrecht, Cat. Cat. i, 272 wiederholt worden. 
Das richtige Datum, 1624 n. Chr., wird Cat. Cat. i, 725 gegeben. 



6 Ich fasse oghopakarana wie Merumahlbhrt (Kirät. 5, 1) ,der Berg Namens 
Mem* oder Samllatä; Benpey, Vollst. Grammatik § 656, v; Whitney §. 1280, b. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 3 

o c 
E =3 

ft3 <D 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



Original from 






w i 

fN CO 

O u 



f 10 - 

O o 

c v> 

o 5 



34 Theodor Zachariae. 

aus einer Reihe von wollnen Fäden gefertigte Besen 1 der Jaina- 
Mönche. Die Richtigkeit von ogha bezweifelte Borooah in seinem 
Nänärthasaijigraha (Calcutta 1884), Notes, p. 59. Er meint, gerade 
die Erklärung des Mahendra beweise, dass argha die richtige Lesung 
sei. Auch in der neuesten Ausgabe des Anekärthasaipgraha, Bombay 
1896, Vers 1175, ist wieder arghopakarana zu lesen. Nur Böhtlingk 
hat dadurch, dass er *oghopakarana n. ,als Erklärung von pavitra 
Besen' in sein kürzeres Wörterbuch v, 251 aufgenommen hat, meine 
Verbesserung anerkannt. Die Richtigkeit von ogha zu bezweifeln, 
wird auch einem europäischen Gelehrten nicht so leicht in den Sinn 
kommen. Wohl aber muss man sich die Fragen vorlegen: lässt sich 
ogha , Besen' erklären? Lässt sich das Wort noch anderwärts nach- 
weisen? Diese Fragen hat Borooah weder gestellt, noch beantwortet. 
Um den oben berührten Einwurf des indischen Gelehrten zurückzu- 
weisen, habe ich in den Göttingischen Gelehrten Anzeigen 1885, 387 f. 
zwei Erklärungen von ogha aufgestellt. Von diesen halte ich jetzt 
nur noch die zweite für richtig. Danach ist ogha ein vulgäres Wort 
(Gujarätl?) für ,Besen', das mit dem Sanskritworte ogha ,Flut, Menge' 
nichts zu thun hat. 2 William Miles, On the Jainas of Gujerat and 
Märwär, Transactions of the Royal Asiatic Society in, 350 gebraucht 
das Wort in der Form owgha, Bürgess, Ind. Ant. n, 17 in der Form 
ughä y derselbe Ind. Ant. xm, 277 in der Form ogha. Wenn Hema- 
candra pavitra mit oghopakarana erklärt, so bedient er sich dabei 
eines vulgären Wortes, wie er und andre Lexicographen auch sonst 



1 Zu welchem Zwecke die Jainas einen Besen tragen, sagt Mahendra nicht. 

Er setzt es bei seinen Lesern als bekannt voraus. Wir wissen es jetzt aus den 

Jainaschriften; vgl. z. B. ZDMO. 38, 3. 6. Aber lange vor dem Bekanntwerden 

der Jainalitteratur haben Europäer über den Besen der Jainas berichtet, über den 
o t» 

Zweck zu dem er getragen, über das Material aus dem er gefertigt wird: so E. Pin- 

heiro (Pinnerus), Van Twist, Philippus a SS. Trinitate. Ersterer, ein portugiesischer 



(T3 



§ S 



Jesuit, schreibt unter dem 3. September 1595 über die Jainas: Antequam sedeant, 
scopis gossypinis expurgant locum, ne fortuito casu vermiculum aliquem sessione 

3 o 

Mogor, Moguntiae 1598, fol. 28% cfr. 21 a . 



5 S 



03 



fD 



sua opprimant et occidant. S. Jo. Bapt. Peruschi, Historien relatio de magno Reg. 



2 Zur Etymologie von ogha ,Besen* vgl. die Mitteilung von Pischel, GOA. 1885^ 



388, n. 3. Mehr vermag ich, aus Mangel an geeigneten Hülfsmitteln, nicht zu geben- 

.E ~o 

-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 35 

bei den Worterklärungen öfters Präkritwörter, insbesondre deäiöab- 
däs, verwenden. Vgl. z. B. Anek. in, 22, wo kälikä = dhüman, 
Nebel, gesetzt wird. Weitere Beispiele habe ich in meinen Beiträgen 
zur ind. Lex. 65 ff., Bezzenb. Beitr. x, 130 f., Gott Gel. Anz. 1885, 
391 ff. gegeben. 

Wenn man von einer Bemerkung des Mahendra zu Anek. n, 52 
{pghah susädhüpakarariepi) absieht, so war bis jetzt noch kein Lexi- 
cograph bekannt geworden, der das Wort ogha ,Besen' überliefert. 
Jetzt kann ich mich auf Sädhukirti berufen, der i, 8 die folgenden 
Synonyma von ,Besen' (nämlich der Jaina-Mönche) aufführt: 

rajoharanam oghah syäd dharmadhvajapavitrake. 1 

Ich halte es für nützlich, diese Wörter — mit Ausnahme des 
bereits behandelten ogha — der Reihe nach zu besprechen. 

Rajoharana ist von Böhtlingk, Wörterbuch in kürzerer Fassung 
v, 162, mit einem Sternchen versehen worden. Allein der Verweis 
auf meine Beitr. S. 88, den Böhtlingk gibt, genügt als Beleg voll- 
kommen. Denn Mahendra a. a. O. verwendet das Wort rajoharana 
,Besen* als selbständiger Autor. 2 Ausserdem kommt rajoharana 
(präkr. rayaharana) sehr häufig vor; das Wort ist vielleicht der ge- 
wöhnlichste Ausdruck 8 für , Besen' in der Jainalitteratur. Vgl. z. B. 
Hern. Parisistaparvan xn, 125 ff.; Prabandhacintämani p. 206, 6. Mehr 
Stellen bei Weber, Verzeichniss n, 1332 im Index. Einen Beleg 
hat Böhtlingk selbst schon gegeben. Er citiert: Hern. Par. 8, 76, 
unter rajohara Besen. Dies ist ein Versehen. An der angeführten 
Stelle steht nicht rajohara, sondern rajoharana, und das Wort be- 



■o 






■o 



<=> o 



(T3 



2 5 



F P. 



u 



1 Dahinter steht: oghänäma. In dieser Weise werden in der Regel die einzelnen 
Synonyma mit einem Stichwort in bhäsä versehen. So folgt auf die Wörter für die 
mukhavastrikä, das Mundtuch der Jainas (mukhänantakam tu mukhavastram ca 
mukhapotikä i, 8) das Stichwort muhapatinäma; vgl. dazu muhapattl Uväsagadasäo 
§ 77, vulgär mohomatl bei Burgess, Ind. Ant. n, 17. Der von Sädhukirti gelehrte 
Ausdruck mukhapotikä findet sich bei Weber, Verz. u, 884 grhltarajoharanamukha- 
potikah, suärävakah; der Ausdruck mukhänantaka ist mir nicht vorgekommen. 

8 Sanskrit -Wörterbuch in kürzerer Fassung i, Vorwort, Seite in. 

8 Ein andrer gewöhnlicher Ausdruck ist z. B. pädapronchana (präkr. päya- 
puTnchana): Sacred Books of the East, vol. xxii, p. xxvm. 

3* 

E =3 

ft3 <D 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



36 Theodor Zachariae. 

deutet hier, wenn ich nicht irre, ,das Fortwischen des Staubes/ vgl. 
rayaharanarp, karMtä im Anhang zur Ausgabe des Pariäistaparvan 
S. 8, 2, und rajoharana ,the act of sweeping'(?) Sik?äsamuccaya 
p. 35, 8. 

Rajoharana findet sich auch in der Zusammensetzung sarajo- 
harana am Schluss des Ärhatadaröana im Sarvadaräanasaipgraha, 1 
in einem Verse, worin das, was den Svetämbara Jainas eigen- 
tümlich ist, kurz angegeben wird. Die Övetämbaras werden hier 
mrajoharanäh. genannt. Cowell 2 übersetzt: The Svetämbaras are 
the destroyers of all defilement. Ich würde übersetzen: Die Sve- 
tämbaras sind mit einem Besen versehen, sie tragen einen (aus 
Wolle gefertigten) Besen. Sarajoharanäh steht im Gegensatz zu 
picchikähastäh — wie die Digambaras gleich darauf im Sarvadar- 
äanasarpgraha bezeichnet werden — , d. h. The Digambaras carry 
peacocks' tails in their hands (Cowell). Der Besen ist der Sve- 
tämbara - Secte eigentümlich, die Digambaras bedienen sich, statt 
des Besens, eines Büschels zusammengebundener Pfauen- 
federn, einer picchikä, mäyürapicchikä u. s. f., vulgär morpinchi 
Burgess, Ind. AnL xhi, 194. — Nicht nur etwa in Jainaschriften, 
sondern auch in der klassischen Sanskritlitteratur sehen wir den 
Digambara (Ksapanaka, Nagnätaka) mit der picchikä auftreten: siehe 
z. B. Harsacarita 54, 2. 168, 2L ed. Eomb., Kädambari 31, 7 Peterson, 
Prabodhacandrodaya 45, 12. 58, 10 Brockhaus, 3 Visnupuräija in, 18 
Anfang (Wilson, Works vm, 207). 






w I 

fN CO 

f\l ^ 

, O) 

o u 



o o 

c v> 
o E 



(T3 



F ö. 



1 In einem Auszuge aus dem Vivekavilasa des Jinadattasuri (Klatt, 
Ononiasticon p. 11). Vgl. ausser den Ausgaben des Sarvadarsanasamgraha namentlich 
Bhandarkar, Report für 1883—84, S. 458 f. (hier Vers 48). 

2 In der Uebersetzung des Sarvadarsanasamgraha von Cowell und Gough, 

London, 1882, S. 62. Vgl. auch Colebrooke, Miscdlaneous Essays i 2 , 452 (mir jetzt 
u 

nicht zugänglich). 

i - 

8 Goldstücker in seiner Uebersetzung des Prabodhacandrodaya (1842) S. 167 f. 

bemerkt: ,Ein Büschel Pfauenfedern wird bei der Beschwörung für erforderlich 

gehalten und deshalb von denen getragen, die sich für Zauberer ausgeben. Besonders 

führen die Jainabettler einen solchen bei sich.' Es geht aus diesen Worten nicht 

deutlich hervor, ob es Goldstücker bekannt war, zu welchem Zweck die ,Jaina- 

bettler' eine picchikä tragen, ferner, dass die picchikä zur Ausrüstung speciell eines 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 



V öl 



TS 



(T3 



O 



F P- 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 37 

Um meine Uebersetzung von sarajoharana zu rechtfertigen, 
will ich hier 1 nur auf die Auseinandersetzung über die Jainalehre 
in der §atdarsanasamuccayatlkä des Guiiaratnasüri 2 ver- 
weisen. Gunaratna unterscheidet zwei Secten, die Svetämbaras und 
Digambaras. Dann fährt er fort: tatra Svetämbaränäm rajoharana- 
mukhavastrikälocädir Ungarn colapattakalpädiko 3 vesah* u. s. w. Cha- 
rakteristisch ist also für die Svetämbaras in erster Linie das rajo- 
harana, der Besen, die mukhavastrikä, das Mundtuch, und der locaf 
das Ausraufen der Haare. Gunaratna hat das rajoharana an die 
Spitze gestellt wie Jinadatta in dem Verse 6 

sarajoharana bhaiksabhujo luücitamürdhajäh \ 
Svetambarah ksamäSllä nissangä Jainasädhavah || 

Cowell beruft sich 7 wegen seiner Uebersetzung von sarajoha- 
ranäh mit ,destroyers of all defilemenV auf den rajoharanadhärin 
(= vratin) bei Haläyudha n, 189. Die Gleichung rajoharanadhärin 
= vratin stammt augenscheinlich aus dem Petersburger Wörterbuche, 



Digambara gehört, und dass der Digambara im dritten Act des Prabodhacandro- 
daya aus diesem Grunde sihisihandapicchiähattho auftritt. — Ob die picchikä der 
Digambaras und die picchikä der Zauberer oder Gaukler (aindrajälika) im Zusammen- 
bang stehn, wage ich nicht zu entscheiden. 

1 Vgl. im Uebrigen GGÄ. 1885, S. 387 n. 1. 3, S. 388 n. 2. 

8 Im Auszug bei Weber, Verz. n, 182; vollständig bei Pulle, Giornale della 



Soc. Äs. Italiana vm, 169 ff. (vgl. 162 ff.). 



8 Von diesen Kleidungsstücken handelt Sädhuklrti i, 9: kalpas tu prac^ 
chadapaß (kalapadänäma); lomapaty aurnikafy pa\ah \ varsäkalpafy (lovadinäma) ; 
kativastre colapaUa iti smrtafy (colavaßnäma) \\ Vgl. im Uebrigen Jacobi, Sacred 



Books of the East xxn, p. 67, n. 3; p. 73, n. 2. 

4 Pulle in seiner Paraphrase dieses Satzes, a. a. O., S. 162, sagt: Distintivo 
degli Svetämbara e un abito munito di un velo per tener la faccia monda dalla 
polvere. — Von alledem ist im Original schlechterdings fast gar nicht die Rede. 
Die mukhavastrikä wird vor den Mund gelegt, um zu verhindern, dass Insekten — 
culex vel musca, sagt der oben genannte Pinnerus — in den Mund gelangen. 

5 Im Präkrit hya, z. B. Kalpasütra 116; = ketotpäfana, Hern. Par. 8, 76. Vgl. 
auch Weber, Verzeichnisa n, 976, n. 

c KD 
'(U ¥? 



6 Bhandarkar, Report für 1883—84, S. 459, Vers 48. 

7 Uebersetzung des Sarvadarsanasamgraha, p. 62 n.: Sarajoharanoh is ex- 



plained by the rajoharanadhärin (= vratin) of Haläyudha, n. 189. 



£ -o 
-ö v 

E-e 

E => 

(ü <D 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

D Q- 



Original fronn 



38 Theodor Zachariae. 

wo Böhtlingk, ich weiss nicht aus welchem Grunde, ein Fragezeichen 
hinter rajoharanadhärin gesetzt hat. — Wie ist rajoharanadhärin 
aufzufassen? Zur Beantwortung dieser Frage wird zunächst die 
Stelle, wo das Wort vorkommt, einer kritischen Beleuchtung unter- 
worfen werden müssen. Haläyudha n, 189 f. lautet bei Aufrecht: 

tapasvl samyatah Santo munir lingl yatir vratl \ 
rajoharanadhärl ca Svetaväsäh sitämbarah || 189 || 
nagnäto digväsäh ksapanak sramanas ca jlvako jainah \ 
äjlvo maladhärl nirgranthah kathyate sadbhih |j 190 || 

Es ist nun auffällig, dass sich in den bekannteren — mir zu- 
gänglichen — KoSa keine Stelle findet, die der ersten Strophe genau 
entspricht. Nur die zweite Strophe ist deutlich in der Vaijayanti 
des Yädavaprakäöa 1 reflectiert (202, 30 f.): 

ksapanairamanau nagno nagnätas ca digambarah \\ 
äjlvo jlvako jaino nirgrantho malaväry (!) api \ 

Yädava, dem Haläy. n, 190 vorgelegen haben wird, hat die 
versfullende Phrase kathyate sadbhVi ausgeworfen und dafür nagna 
hinzugefügt, für digväsas hat er das gewöhnlichere digambara ein- 
gesetzt und das Metrum geändert. Sonst vgl. noch Härävall 115 
ed. Bomb., wo nagnätaka, nirgranthaka (nirgandaka v. L), bhadanta 
und digambara(ka) mit der Bedeutung nagna überliefert werden. 
Auf Härävall 115 scheint, zum Teil, Sädhukirti i, 6 zurückzugehen: 

nagnätako bhadantai 2 ca niguntakadigambarau \ 

nagnah ksapanakafy käryaputah 3 k§apana ity api \\ 



2 1 

1 Oppert tibersetzt im Vocabulary of the Vaijayanti die Wörter von kfapana 

bis digambara mit ,naked', die Wörter von äjiva bis malavärin (!) mit ,Jaina beggar'. 
Maladhärin (so ist bei Oppert zu lesen!), eigentlich ,Schmutzträger', ist eine sehr 
passende Bezeichnung eines Digambara Jaina; vgl. z. B. Prabodhacandrodaya 
45, 10. Thatsächlich findet sich Maladhärin als Beiname nicht nur von Digam- 
baras, sondern auch von Svetämbaras: vgl. z. B. Peterson, Third Report (1887), 
p. 28 und namentlich die Mitteilungen von Leumann (nach Klatt), Epigraphia 
Indica in, 188 f. 

2 Hern. Un. 222 bhadanto nirgranthe?u 6äkye#u ca püjyafy. 

in tr> 

3 Vgl. Hem. Anek. iv, 58. 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



T3 



Ö. ^ 
V öl 



Cl 



O o 









Nachträge zu dem syn. Wörterbuch des Hemacandra. 39 

Wenn sich wirklich kein Reflex von Haläy. n, 189 in den 
jüngeren Wörterbüchern finden sollte, so verdient der Umstand, dass 
die Strophe nicht in allen Handschriften steht, Beachtung. Die 
Strophe fehlt gerade in der ältesten, datierten, von Aufrecht be- 
nutzten Handschrift; sie fehlt auch in der Ausgabe des Haläyudha 
im Satkofiasaipgraha (Benares 1873). Diese Ausgabe bietet aufS. 27 
die 190. Strophe mit dem Stichwort Jainanäma und fügt dann noch 
eine Strophe, die ihrem Inhalt nach mit Str. 189 bei Aufrecht über- 
einstimmt, hinzu (mit dem Stichwort muninäma): 

munis tapodhano hi syäd virato 'kimcano vratl \ 
anagarah 1 pravrajitah Svetaväsäs tu samyatah || 198 || 

Diese Strophe, die Aufrecht in keiner von seinen sieben Hand- 
schriften gefunden hat, wird man, schon wegen des ganz unpas- 
senden tu, für eine Interpolation erklären müssen. Thut man das 
aber, so ist es nur ein Schritt bis zu der Behauptung: auch Str. 189 
bei Aufrecht ist interpoliert. 2 Mindestens ist es sehr zweifelhaft, 
ob Haläyudha das Wort rajoharanadhärin wirklich überliefert hat. 

Indessen, da sich das Wort in mehreren Handschriften des 
Haläyudha findet, und da es auch in unsre Sanskritwörterbücher 
aufgenommen worden ist, so muss es erklärt werden. Das ist sehr 
gut möglich, wenn man nur Haläy. n, 189 f. im Zusammenhang 
betrachtet. Aufrecht im Glossar zum Haläyudha erklärt die Wörter 
von tapasvin bis vratin mit ,ascetic', ,one who controls his passions' 
u. dgl.; rajoharanadhärin (Glossary, p. 319) bleibt unübersetzt ; die 



cn 



(T3 






1 Lies anagärah, der Heimatlose. Dieses im Sanskrit noch nicht belegte 
Wort findet sich z. B. Hem. Par. 12, 317. In der heiligen Litteratur der Jainas ist 
anagära (präkr. anagära) sehr häufig. 

2 Ich kann nicht alle Gründe anführen, die mich bestimmen, Hai. n, 189 für 



eingeschoben zu erklären. Man beachte nur, dass die Wörter von tapasvin bis 
vratin (mit Ausnahme von lingin; siehe unten) sämtlich auch anderswo im Halä- 
yudha vorkommen, und zwar dort, wo man sie erwarten muss. Wenn der Saus- 

3 o 

kritcommentar zum Haläyudha veröffentlicht sein wird, wird sich eine kritische 
Frage wie die vorliegende leichter erledigen lassen. Die einzige Handschrift des 
Commentars die ich kenne beginnt erst mit n, 339. Ziemlich vollständig dürfte die 

Handschrift sein, die Peterson, Sixth Report (1899), p. 94, verzeichnet hat. 

o "E 
E => 

(ü <D 
to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



40 Theodor Zachariae. 

Wörter ven Svetaväsas bis sramana bedeuten nach Aufrecht 7 a 
(naked) Bauddha mendicant', die Wörter von jtvaka bis nirgrantha 
bedeuten ,a Jain mendicant' u. dgl. Diese Uebersetzungen können 
nur zum Teil richtig sein. Denn im Haläyudhakosa * ? sehn wir 
im allgemeinen Artikelschluss und Schluss eines Verses oder Vers- 
teiles zusammenfallend Mit nagnäta Str. 190 beginnt ein neuer 
Artikel, eine neue Reihe von Synonymen. Die Wörter nagnäta, 
digväsa8 u. s. w. bis nirgrantha sind Wörter für Jaina, und zwar 
insbesondre für Digambara Jaina. Man denke nur an den 
schmutzigen Nagnäfaka, der mit einem Bündel Pfauenfedern in der 
Hand im Harsacarita 168 auftritt, und vergleiche noch Bühler, Ind. 
Ant. vh, 28, Weber, Verz. n, 956 n. Wir wenden uns zu Strophe 189. 
Die Wörter von tapasvin bis vratin — auch lingin 2 — können 
alle ebenfalls auf Jainas bezogen werden: dass Svetämbara Jainas 
gemeint sind, scheint daraus hervorzugehn, dass die Strophe mit 
ivetaväsah sitämbarah schliesst. Diese beiden Wörter bedeuten sicher 
nicht einen buddhistischen Bettler — wie Aufrecht will — , 
sondern einen Svetämbara (weissgekleideten) Jaina. 3 Was sitäm- 
bara betrifft, so habe ich auch Böhtlingk auf meiner Seite. Zum 
Ueberfluss will ich aber noch Belege geben: Svetaväsas = Svetäm- 
bara findet sich z. B. im Kupaksakauäikäditya bei Weber, Verz. n, 
980; sitämbara wird ebenso gebraucht im Prabandhacintämaiii 107, 
16 und sonst oft. Es bleibt rajoharanadhärin übrig. Da das Wort 
nur durch das Flickwort ca von svetaväsas getrennt ist, so wird 
man es als ein Synonym von »Svetämbara anzusehn haben. Wer 



T3 






w i 

fN CO 

O u 



o o 

c v> 
o E 



F P. 



1 Bühlers Grundriss i, 3 B, Seite 10. 

2 Eigentlich einer, der die Abzeichen hat. Vgl. ausser der oben aus Guna- 



samgraha von einem Svetämbara Jaina interpoliert worden, der specielle Aus- 



ratnastiri citierten Stelle namentlich Leumann in der Einleitung zu seiner Ausgabe 

**- ~° _ 

des Aupapatikasütra S. 14 f. 
jfr ■ - 

8 Irre ich nicht, so ist Haläy. u, 189 bei Aufrecht und u, 198 im Satkosa- 

> <ü 

drücke für Svetämbara bei Haläyudha vermisste. (Man könnte den im Vivekavilasa 
hinter Vers 48 eigeschobnen Vers vrataMäh zum Vergleich herbeiziehn; s. Bhan- 
darkar, Bep. für 1883 — 84, p. 459.) Warum Haläyudha — oder der Vorgänger, 
den er ausschrieb — die Di?ambaras bevorzugt hat, lässt sich nicht feststellen. 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

— 

ü Q_ 



Original fronn 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 41 

aber weiss, dass die Övetämbaras ein rajoharana, einen Besen, 
tragen, dem ergibt sich die Erklärung des Wortes ganz von selbst: 
rajoharanadhärin ist = sarajoharana und bedeutet eigentlich ,Besen- 
träger', genau wie rajoharanadhärana ,das Tragen des Besens' be- 
deutet in dem Verse (ZDMG. xxxviii, 3) : 

jantavo bahavah santi durdrSä mämsacaksusäm \ 
tebhyah smftarrt dayärtham tu rajoharanadhäranam || 

Die vorgetragne Erklärung von rajoharanadhärin habe ich 
bereits 1883 in meinen Beiträgen zur ind. Lex. S. 88 angedeutet. 
Ich halte auch heute noch daran fest, obwohl vor Kurzem eine ganz 
andre Erklärung aufgestellt worden ist. Rajoharana findet sich 
nämlich — wie Böhtlingk zuerst vor mehr als 25 Jahren im Pet. 
Wörterbuch unter harana und dann wieder in der kürzeren Fassung 
vn, 370 angegeben hat — auch im Kausikasütra (13, 11). Bloom- 
field in seiner Ausgabe des Kauäika p. liii führt rajoharana unter 
den Wörtern auf, which have not been found hitherto outside of 
the Kausika. Dass das Wort rajoharana ganz gewöhnlich ist, haben 
wir gesehn. Anders stehts mit der Bedeutung des Wortes im 
Kausikasütra. Die mehr oder weniger corrupten Commentare des 
Därila 1 und Kesava erklären — wenn ich sie recht verstehe — ra- 
joharana mit äkäsodaka, das, wie z. B, gaganämbu, ,Itegen, Regen- 
wasser' bedeutet. Dementsprechend übersetzt Caland in seinem vor- 
trefflichen ,Altindischen Zauberritual' (Amsterdam 1900) S. 26 rajo- 
harana mit ,Regen'. Wenn sich aber Caland auf rajoharanadhärin 
Haläy. n, 189, ,welches vratin bedeutet', beruft und meint, dieser 
Ausdruck bedeute eigentlich ,der den Regen erträgt', so kann ich 






w i 

fN CO 

O u 



o o 

c v> 
o 2 



F P. 



dieser Auffassung nimmermehr zustimmen. Wäre es nötig, zu be- 
weisen, dass rajoharana (das was den Staub fortnimmt) ,Regen' oder 
dgl. bedeuten kann, so läge es nahe, Kaccäyanappakarana, Kibbi- 
dhänakappa i, 25 herbeizuziehn [rajam harattti: rajoharanam toyam). 



Siehe Childers unter rajoharana. 

CO 

5 S 

1 Eaja udakam ucyate be,i Därila habe ich nicht übersehn. Zu rajas ,Wasser 
S ~o 

vgl. Geldner in den Vedischen Studien n, 265. 

3** 

fD O) 

in 4-/ 
$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



42 



Theodor Zachariae. 



TD 



ö. ^ 

.C o 



Als Synonyma von rajoharana überliefert Sädhukirti noch dhar- 
madhvaja und pavitra(ka). Ersteres Wort kann ich nur durch einen 
Hinweis auf Hern. Par. xn, 126 tad rajoharanarri dharmadhvajam 
ädatsva wie y nagha belegen. Interessant ist, dass Abul Fazl, ein 
Zeitgenosse des Sädhukirti, dharmadhvaja gebraucht. Siehe Am i 
Akbari, translated by Jarrett, vol. in (1894) p. 20b: They [the Jain 
ascetics] carry a Dharmadhvaja made of woollen hairs like a tassel, 
bound with scarlet cloth and fixed in a wooden handle. As they 
constantly sit on the ground, they first gently sweep it with both 
hands that nothing may remain beneath. 

Pavitra ,Besen' auch bei Hemacandra Anek. 3, 568. Der 
Commentator Mahendrasüri citiert als Beleg: pavitrapänayo dviträs 
taträjagmur muriiSvaräh. Die Stelle stammt vermutlich aus einem 
der grossen Kävya des Hemacandra. Im Anschluss an Jacobi, Sacred 
Books of the East 22, p. xxvm mache ich noch darauf aufmerksam, 
dass pavitra, das Seihtuch, von Govinda zu Baudhäyanadharma- 
Sästra ii, 6, 11, 24 mit ,a bunch of Kusa grass for removing in- 
sects from the road 4 erklärt wird. 



Verzeichniss der erwähnten oder besprochenen Wörter. 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



u 

O <L> 

*S 

■h! ■— 

£ ? 
> <u 

C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

■o E 

(U o 
1o Q 

ü Q_ 



anagär a 39. 
anindriya 30. 
antarindriya 30. 
antika 16. 
antisad 29. 
abhiluhkhita 29 n. 
arghopakarana 33 f. 
ä 30. 

äkäsodaka 41. 
älunkhita 29 n. 

idävatsara 18. 
idvatsara 18. 
2 30. 



wgfAä 34. 
uccilinga 18. 
ucchara 21 n. 
ucchiras 21 n. 
ucchuna 21 n. 
utsara 21 n. 
tmä (!) 18. 
wsas 18. 

ekabhü 1 7 n. 
ekänasi 18. 
ekäntaropaväsa 22 n. 
ogfÄa 33 ff. 
oghopakarana 33 f. 



kataka 28 n.; 30. 
katltala 31 n. 
katlvastra 37 n. 
kadatala } °lä 31 n. 
kaditala } Hula 31 n. 
kadintala 31 n. 
kalapadä 37 n. 
fcaZpa 37. 
kärttikika 22 n. 
käläksarika 26 n. 
kutaka 28 n. 
kücchalinga (!) 18. 
keSotpätana 37 n. 
ksapanaQca) 38. 



.oo 



gle 



Original from 
CORNELL UNIVERSITV 



Nachträge zu dem syn. Wörterbuch des Hemacandra. 43 



0} 
T3 



Ö. ^ 



T3 

4+: 



gaganämbu 41. 
guccha 26 f. 
guücha 26 n. 
guluccha 26 n. 
guluficha 26 f. 
gulunchu 27. 
gfhacandra 28 n. 
grahakallola 28 n. 
ghasuri 18. 

cutoZs, °<?wfo 28 n. 
cwpfana 24 n. 
corad.a 18. 
colapatta 37. 
colavatä 37 n. 

jampäna (!) 25. 
jhampäna 25. 
jharanka 28 n. 

tälüra 28 n. 



pattisa 18. 
pavitra(ka) 33 ff.; 42. 
pädaprofichana 35 n. 
pädaMl 28 n. 
päyapumchana 35 n. 
piccha 26 n. 
picchikä 36. 
pincha 26 n. 
|Wicfö 26. 

puskara ; Sonne' 22 n. 
pracchadapaü 37 n. 
jprato' ,Copie' 14. 

bappa 19 n. 
ftäjpa 19 n. 
brahman ; Sonne' 22 n. 

bhattäraka 15 n. 
bhadanta 38. 
bharataka 15 n. 
bharbhari 18. 



mukhavastrikä 35 n.; 

37. 
mukhänantaka (?) 

35 n. 
muhapatl, °pattl 35 n. 
mülaprati 14 n. 
mülärka 31 n. 
morpifichi 36. 
mohomatl 35 n. 

yauvanika (!) 25. 

ra/as , Wasser' 41 n. 
raj ohara (!) 35. 
rajoharana 33. 35 ff. 
rajoharanadhärin 

37 ff. 
rayaharana 35 f. 
rasäyu 28 n. 
rificholl 26 n. 
ruüjita 28 n. 
rota 28 n. 



rN ,_; 



F P. 



u 

O <L> 



CD 



=> O 

— o 



in 



rc 

£ oJ 

_^ 03 

.E -ö 

-ö £ 

E => 

fD 0) 

in 4-/ 



0) o 

ü Q_ 



<2anu?a(!) 19. 
digambara(ka) 38. 
digväsas 38. 40. 
dipälikädina 33 n. 

dharmadhvaja 35. 42. 
dhümari 35. 

nagna 38. 

nagnätaQca) 38. 40. 
niguntaka (?) 38. 
nirgandaka 38. 



manjlra 28 n. 
mandlra 28 n. 
maya 30 n. 
wiat/w 30 n. 
mayuka 18. 
mayüka (!) 18. 
marya 30 n. 
maladhärin 38. 
malavärin (!) 38. 
mäyürapicchikä 36. 
mukhapotikä 35 n. 
mukhavastra 35 n. 



.oo 



gle 



lambikä 26 n. 
Zam&I 28. 
Ztftjra 37. 
ZiÄgrm 38 ff. 
°lu?ikhita 29 n. 
Zttroftt, °I 26 ff. 
lumbikä 26 n. 
Zoca 37. 
lomapatl 37 n. 
Zoya 37 n. 
lolaghanta 17. 
lovadl 37 n. 



Original frarn 
CORNELL UNIVERSITY 



44 



Th. Zachariae. Nachtrage zum syn. Wörtbrbüch etc. 



IN ,J 



!2 £ 

= 1 

- "r? 

F P. 



vappa 19. 
vapra 19. 
varsäkalpa 87 n. 
vädlndra 33. 
vöpya(!) 19. 
visarjwthula 32 n. 
vrddhetara 23. 
vellahala 29 n. 



iamaJcfty 9 bhft 32 n. 
Singhänaka 19. 
4vetaväsa8 3 8 ff. 

samudragfhaka 29 n. 
sarpbharana 29 n. 
sarajoharana 36 f. 
sirrthänaka 19. 
sitämbara 38. 40. 



suSrävaka 35 n. 
Susumna 22 n. 
8U8ädhu 35. 
8airin 22 n. 
8neharekabhü(l) 17 n. 
«neAw 17 n. 

hanusa 19. 



■o 






T3 

4+: 



Halle a. d. S. 



u 

«4- "° 

O <L> 

*S 

■h! ■— 

'i/i öi 

> <U 

C CT 

=) O 

- o 

5 S 

.E -ö 

"ö 

■o 

O 



03 



-i-j 

'c 



(U o 

ü Q_ 



lOO 



gle 



Original from 
CORNELL UNIVERSITV 






Bemerkungen zu Doughty's Travels in Arabia Deserta. 

Von 

J. J. Hess. 

Doughty's Reisewerk ist von berufener Seite wiederholt be- 
sprochen und gewürdigt worden. Als Fundgrube sehr vieler Einzel- 
heiten geographischer und kulturhistorischer Natur verdient es reiche 
Beobachtung eines Jeden, dem die Kunde Arabiens und des Ara- 
bischen am Herzen liegt. Leider ist aber seine Benutzung nicht 
wenig erschwert durch die eigenthümliche Art wie Doughty das 
Arabische transcribiert, sowie auch durch häufig bei ihm zu consta- 
tierende Fehler im Auffassen der gesprochenen Laute. Diese Un- 
ebenheiten werden in dem von kundigerer Hand revidierten Index 
nicht immer soweit ausgeglichen, dass über Form und Bedeutung 
der Wörter kein Zweifel mehr aufkommen könnte. 

Ich glaube daher den Benutzern des Werkes einen Dienst zu 
erweisen, wenn ich für eine grössere Zahl von Wörtern des Doughty- 
schen Index die correcte Form und Bedeutung gebe. Meine Wort- 
formen sind, wo nicht das Gegentheil gesagt ist, stets dem Dialecte 
der Gahtän entnommen. Die Lautschreibung ist die aus Gaspari's 



■o 

Q- 



.TD 






(T3 



= 1 

F P. 



u 

«4- ~° 

O <L> 



arabischer Grammatik bekannte, nur bemerke ich, dass palatalisiertes 



C CT 
=) O 

— o 

c ü 

ifl tn 

£ -o 
-o v 

E-e 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



A: und k mit (stimmlosem) te und (stimmhaftem) dz, das nicht palatali- 
sierte k mit </ umschrieben ist und mache darauf aufmerksam, dass 
d und z beide gleich und wie ein emphatisches (hohes) d aus- 



Original from 



TD 






46 J. J. Hess. 

gesprochen werden. ' und A bezeichnet betonte Silben, ~~ unbetonte 
Längen. 1 

543. 'ddde 'aläne auch 'ddde r al ähüne (UJLa\ ^^s. ^$S*). 

544. Beul 'Abdule eine Unterabtheilung der Meter] auf der Kiepert- 
schen Karte ,Die Nilländer und Westarabien' fälschlich Benz 
'Abdallah. 

545. 'Ööicfe; die Gahtdn zerfallen in drei Gruppen ubide, AI Mo- 
hammed und el-öehddir. 

Statt abu tawfah habe ich el-waham als Name der Cholera gehört. 
r abüd wurde mir erklärt als die Pflanzen, die aus den Körnern 
entsprossen, die zufälligerweise an einem Lagerplatze nieder- 
fallen und dann vom Regen bewässert werden; auch me&bbed. 

546. 'Adan ist verhört, el-'addme pl. el-adam ist ein grosser, koni- 
scher Sandhügel auf einem c erdz (q. v.). 

Adilla lies 'Adle. Die von Doughty S. 427 angeführten Namen 
von Hunden lauten correct wie folgt: 



Für einen Hund 


Für eine Hündin 


*'Adwdn 


'Ädive 


Sa'ldn 


Sä'le 


*Süwdn 2 




*Nezzäl 




*Mü§i 




*Reäddn 


Rdsde 


Dogmän 


Düflme 


*'Amrdn 


'Ämre 


Torfdn 


furfe 


*Hwejis 


HwejiSe (?) 


Nimrdn 


Nimre 


Hefildn 


Hefe 


Hedbdn 


HSdbe 



Q- 



O o 

c v> 
o E 

^-^ 4-1 

TD ±3 

- "r? 

£ ö. 

P 

U 
O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 

B ° 

kommen zuliebe mit dem Längezeichen versehen, in Wirklichkeit ist sie kurz. 

2 Die mit * bezeichneten Namen sind nicht gahtänisch, sondern von einem 

.. • 

Manne aus 'Anize. 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



1 Die Endung l = ^ habe ich der klassischen Orthographie und dem Her- 



Original fronn 






Bemerkungen zu Doughty's Travels in Arabia Deserta. 47 



T3 



03 



Für einen Hund 


Für eine Hündin 


' Agldn 


c Ägle 


Tögdn 


Töge 


*Zugmän 


Zügme 


*Debldn 


Deble 


Serän 


Se're 


*Hawdm 


Home 


*Bögdn 


Böge 


'Iddn 


l Ide 


*Fegwän 


Fegwe 


Hazzdn 


Hdzze 



Auda (lies ''öde) ist nicht ein Name, sondern bezeichnet ,die 
alte Hündin, Eselin oder Stute'. Die Bemerkung ,Sowwan (whose 
mother was Sowwa)' ist unrichtig. 

W. Adziz ist identisch mit W. Agig S. 547. Die 'Ötebe sprechen 
W. el -Adzidz, die Harb W. el -'Agig. Doughty hat sieh dadurch 
verleiten lassen zwei Thäler in seine Karte einzutragen. Vergl. 
Huber S. 740. 

o 

el-'edd pl. el-'edüd ist ein Ort mit vielen und wasserreichen 
Brunnen (gülbdn und hesjdri). 

Für 'afrit sagen die Gahtdn e-süknl pl. e-sukün, auch el-ginnl 
pl. dl-ginn. 

el- c efrl pl. el-afdrje 7 kleine langhalsige Gazelle von hellgrauer 
Farbe*. 

Die Orte von l-Afldg lauten: e-Seh auch Seh el- Hamid, Lele 
auf S. 620 fälschlich Leyta geschrieben, el-Hdrfa, e-R6da, el-Bedi. 

el-ögdb pl. el^ögub ,the small swartbrown eagle*. 

el-ogdl pl. el^dgul ; die Kopfschnur' heisst bei den Gahtdn el- 
'emdme pl. el^amdjim. 

el-6gele pl. el J ogal [D. dgella und d^illa] ? Brunnen mit süssem, 
aber spärlichem Wasser in einer Ebene'. 
547. Aitha ist wohl ide, ein häufiger Name für ein delül (für die 
Verwechslung der d-Laute vergl. ahl afhab = ahl äddb). 

el-ädzde pl. el-ädzddt ^Stadtmauer*. 



<=> o 

c ^ 
o E 

^-^ 4-1 

■o -b 

i 

*t 

- "r? 

£ ö. 

P 

U 

O <L> 

N 
'-I-J 

"o 

fc =9 
> <u 

C CT 

c 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



48 J. J. Hess. 

el-yeleb pl. l-agldb ,Hausthiere (Kamele, Ziegen, Schafe, aber 
nicht Pferde), die man zum Verkaufe auf den Markt treibt'. 
548. Ach, aus dem D. wohl nur durch Analogie AK erschliesst, lautet 
bei den 'Otebe: el-Atts y bei den Gfahtdn: el-*AttS] es ist der Batn 
al-Aik des Hamdäni (141, 21), der den fwedz (jfe^) in west- 
östlicher Richtung durchbricht und dessen Ursprung in der Nähe 
von el-Gasab ist. Die von Hamdäni (auch Jac. i, 705) erwähnten 
el-BJcardt (so ist die jetzige Aussprache), drei konische Berge, 
liegen südlich vom el-'Ätts hart an der Westseite des Twedz. 

Aleije (Doughty n, 42) ungefähr zwei Tagereisen N. von el- 
Haridz auf der Höhe des Twedz (ohne Artikel, aber wohl identisch 
mit iuüJl Jac. iii 716). 

553. 'AremiS ist ein häufiger Männername. 
Die nach D. zu el- Arid gehörigen Orte heissen Mamfuha, el- 

Hdjer (das pj£&'y\£*- des Jac. ii, 189), °Zruma (U^t Kiepert's 
Nilländer: Dordmd) 'Arge kenne ich nur als r edd zwischen Nefl 
(ohne Artikel, cf. auch Huber 111 !) und e-Dwddmi. Ein anderes 
'Arge wurde mir angegeben zwischen Tomije und el-Hnähije. 

554. el-'ötfe pl. el-ataf bezeichnet nicht nur ,a damsel', sondern den 
eigenthümlichen Sattel mit sammt dem Mädchen; bei den Gahtdn 
sagt man dafür el-mzeijin. 

Die Impfung heisst sowohl el-äddb als el-'äddd (weil am Ober- 
arm: el- c ddd vorgenommen). Der Impfer heisst el-me'dddeb, der 
Geimpfte elme'ddded. 

Statt Atheba lies 'Adbe. 

e-deödb pl. l-idibbe ,Fliege', nicht ,wilde Biene*. 

I-Atule ist zu lesen statt Atüle (statt / ist vielleicht t zu setzen). 

555. el-Wahaldn heisst der Ort, den Doughty 'Auhelan und Huber 



V öl 



■o 



03 



<=> o 



(T3 



U 



710 Ouahdn schreibt. 

> -S 

Von einem Dorfe el-Aijathdt habe ich nie sprechen hören, wohl 

aber von einer Abtheilung der Dittcdsir el-Gijätdt sing. el-Gijeü] 



ebenso kenne ich eine Abtheilung e-Suwdige sing. e-Sdidzl, die 



=> o 

— o 

D. ebenfalls als village es-Showyg aufführt. 
Lies 'Ain e-Swenä\ 

E =3 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original fronn 



O Q_ 









(T3 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 49 

Z-i&# ir f a2<z& heisst ,die Kamele weiden fern vom menzil und 
verbringen auch die Nächte weit von ihm'; die Gahtdn sagen el- 
bil 'äzib. 

556. Die Stücke eingetrockneter Milch heissen el-bdgel nom. unitat. 
el-bdgle. Die Gahtdn sagen dafür l-iigt nom. unitat. l-ügta. 

el-baküre pl. el-bowätsir hat wie der ehmihgdn pl. el-mehägin 
die Form *], ist aber dünner alß dieser, el-mi&db plur. el-mesaib 
hat die Form 1; el-'asa pl. el-'asi und el-mdtrag plur. el-matdridz 
sind glatte, grade Stöcke, der letztere ist dünner als der erstere. 

557. el-Berüd auch el-Borüd Ort im W 7 «^ e-Sirr. 
el'Bdtin der jBafri 2*aZ# der Klassiker. 
el-Bediya ist nicht in el-Jemen, sondern mit auf S. 546 erwähntem 

el-Biddea identisch; s. oben S. 47. 

559. el-bele§ morbus gallicus wird behandelt mit ösbe ,Sarsaparilla'. 

560. el-börga pl. el-barddze ,der Schleier, der das Gesicht mit Aus- 
nahme der Augen ganz verhüllt'. Der Schleier, der demjenigen 
ähnlich ist, der in Aegypten getragen wird und die Stirn frei lässt, 
heisst bei den Gahtdn el-miltem pl. el-meldtim. 

Statt bersim sagen die Beduinen wohl durchwegs el-dzett. 

el-Bertha, auf der Karte el-Berrtha, heisst in Wirklichkeit el- 
Bertse oder Bertset e Zbede, bei den Harb Birket Zbede. 

Dass el-Berüd auch Bessdm heisst bezweifle ich sehr, niemand 
weiss etwas davon. Der auf der Karte von Kiepert angegebene 
Ort Bessam ist sicherlich verschrieben für 'Öbäsdn, ein *edd f der 
an der Strasse zwischen Sdgra und e-Dwddml liegt. 

561. el-Begüm sing. el~Begimi, Stamm im Wddl Trübe. 



~o 



Man sagt mit dem Artikel 61-bil, aber ohne Artikel ibil, z. B 



u 

«4- ~° 

O <L> 



CD 



TD 



=> O 



ibU Mohammed gddet ,die Kamele Mohammeds haben geweidet'. 
562. Von Wddl Bise (ohne Artikel) ist mir bekannt e-Nedzi resp. 



e-NegV und el-Genene auch Genenet BUe. 



563. el-batin wurde mir erklärt als eine Ebene, die parallel an einem 



langen Berge liegt. Sicher ist, dass die Ebene, die zwischen el- 
'Er dz (eine lange Dünenkette, die die Ostgrenze von el-Wrsm 
bildet) und dem Gebirgszuge Twedz liegt, el-Battn heisst. 



£ -o 
-o v 

Wiener Zeitschr. f. d. Kunde d. Morgeul. XVI. Bd. 

ft3 <D 

in 4-/ 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



50 J. J. Hess. 

564. Lies el-ß&kerije statt el-BuJckerteh. 

Das Kamel, das zum ersten Mal geworfen hat, heisst el-bitsir 
plur. l-abkdr. 

567. Die Katze heisst bei den Arabern el-gdtü pl. el-gStdwe oder auch 
el-bess pl. el-büsdse. Die Hddar haben wohl welche, die Beduinen nie. 

el-Cheffy y Keheyfy, Chuwa (!) wird von allen Leuten des Negd 
e-Tshdfe gesprochen, auch Huber transcribiert Etzhafe. Jacüt iv, 
332 al-Kdhfah. 

Für Beul Keläb hörte ich Berti AJcleb oder Beut Jiklibe. 

568. Chol, von den Arabern Tsöl gesprochen, ist türkisches Jy*. tsöl, 
bei den Beduinen wohl kaum bekannt. Ich hörte es von Städtern. 

570. e-datse und e-daetse wurden mir definiert als ,ramle sugdijere 
u-sahle biha f ösb 6 y eine kleine mit Kräutern bewachsene Sandebene. 

e-Deßne (mit Artikel) mit tiefen gemauerten Brunnen (gülbdn) 
Jacut ii, 550: ad-Datinah. 

Statt el-Dam ist e-Lddm zu lesen. Möglicherweise ist e blos 
prosthetisch und Elddm wäre f < jJ, wie Elsdfe = äiU»J. 

571. Wddl e-Duwäsir. Die correcten Formen der angeführten Namen 
sind el'Hmdm, e~Sdtbe y wohl das as-Satbatdni des Jac. iii, 289, 
e-Sleijil, Tdmre (Jac. i, 874), e-Lddm, el-Ldgf, Fdra oder Fdv'at 
el-Wddl. eth-Thellum ist mir nicht bekannt. 

ed-Dellam augenscheinlich dasselbe wie ed-Dillum p. 572. Beide 
sind vielleicht verschrieben für e-Selem, das mir als Station und 
Wddl zwischen el-Hdrg und el-Höta angegeben wurde. 
573. Lies e-Dwddml mit Artikel; lies e-Döh. 



~G 






■o 



i fö 
O o 



574. Statt dubba lies e-debä nom. un. ebenfalls e-debä. 

iE ^ 

Für dullu lies e-delü plur. e-dell. 






575. Das Harz el-elU kommt nach meinen Erkundigungen vom Baum 
e-tö'lüge plur. e-ta'älidz. 

576. Lies l -Engel] el-tirg resp. el-'tirdz. 

577. I -title ist durchaus nicht ein ,ruined site' sondern ein Ort 
c. l x / 2 Tagereise südlich von e-Ras$. 

578. Der Korb, in den die Kaff e topfe, Tassen u. s. w. gesteckt 
werden, heisst bei den Gahtän el-güne, gunet e-deldl. 



u 

«4- ~° 



fD 

£ -o 
-ö £ 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 51 

Statt Feha lies Fefa. 

579. Dass el-Fer'a der Name für den District umfassend die Orte 
eVHöta, el-Haridz, el-Helwe y Na dm ist, glaube ich nicht, da mir 
ein weitgereister Kaufmann aus el-H6ta ausdrücklich versicherte, 
dass ein Gesammtname für diese Städte nicht existiere. 

el-Fdra in el-WeSm wird gewöhnlich Fdrat USedzir, 
el-Fdra ,in the South country' (bei Kiepert Nilländer: el-Fdra) 
Fdr'at el-Wudain genannt, auch Fdrat el-Wddl. Letzteres hat 

00 

den Namen davon, dass es am höchsten Punkte des Wddl e-Du- 
wäsir liegt, das gegen Osten zu sinkt. 

Ferfeyn ist Ferdzen Huber 714, Hamdäni Bat Firkdin. 

580. Der arabische Name für getrocknetes Fleisch ist e-serih. 

582. Statt Fürje lies Firge. 

fN 

Wenn die Uebersetzung D.'s ,fuzzna we had been up and 
after them' richtig ist, so muss fezane transcribiert werden. 
fezW r ala heisst , verfolgen', fdz min ,weggehen von'. 

Statt Gabbily lies { Gbäle vgl. Hüber 716. 

el-dzdble , morgen'. 

583. Die 'Aneze sagen galjün nicht galjün. 
el-gäna pl. el-dzenjdn heisst doch nur Rohr, clubstuk müsste 

heissen *d§ä gdna. 

el-gdre pl. el-gwar hat meines Wissens nie eine andere Bedeu- 
tung als ,kegelförmiger Berg'. Wenn i, 547 wirklich der ,oasis 
soil' gemeint ist, so lautete das Wort wohl el-gardre 7 was mir 
mit e-sahel ,Ebene' erklärt wurde. 

Gdrat Utetie ist zu lesen an Stelle von Gdrat Owsheyfia ; da / 
und t in den Negd-Di&lecten beide stark gehaucht werden, so 
sind sie leicht zu verhören. Dass dieselbe ein Wallfahrtsplatz 
war, wurde mir nicht berichtet, wohl aber, dass es die höchste 
Gare in ganz el-Wiim sei und dass sich auf ihr alte Ruinen von 
den Helälije herstammend befinden. Sie liege in der Nähe von 






w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



~ O) 
_N 
'-I-J 

> <u 

3 o 

üj&te (= Utaißjah Hamdäni 163, 24, Jac. 1, 121). 

Gdrat e-Terl ist nicht identisch mit Gdrat Utetie, der Verlust 
einiger Notizen verhindert mich ihren Ort genau angeben zu 



TD 



* b w iwuüvu fVlumuv ' il " uvu *"*v,*x v_, A * b U """ t% "t5 v 



4* 



z> 

fÖ 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



52 J. J. Hess. 

können, ich erinnere mich nur noch, dass sie ebenfalls in el- 
WeSm sich befindet. 

584. Statt el-Geryen lies el-Gerine resp. el-Dzerine, ein Ort in el- 
Wtim. 

Statt Geserra lies { Gzdra, ein Brunnen (dzelzb) am Nordende 
des Twedz 7» Tagreise nördlich von e-Zilfi (Jac. ii 59 ?). 

585. Röthel heisst el-magar; an der Richtigkeit von ghrerra zweifle 
ich. 

el-gog (c**^) plur. el-güge ist der Hengst. 
Was D. el-ghrullathi schreibt, lautet el-gdlt nom. un. el-gdlte. 
Der Plural von el-gine lautet wie im ägyptischen Dialect el- 
ginehdt. 

586. el-gow pl. el-gijdn ist nicht ein ,seyl bed', sondern eine rundliche 
Niederung, in der zur Regenzeit das Wasser stagniert. 

el-Gweye ist zu schreiben statt Goayieh. Es giebt auch ein 
el-Gwe etwa 7* Tagereise SW. vom vorigen, da dies jedoch ein 
unbedeutender Ort ist, so wird mit dem el Kwei der Kiepert- 
schen Karten wohl das erstere gemeint sein. 

Für Granit hörte ich wie Hüber den Namen e-dekar. 

587. Für Gutta lies el-güti pl. el-gowdti. 

588. el-hadiig plur. el-hedig ist ein weibliches Lastkamel. 
el-Hafar auch Hdfar el-Bdtin y bei Jac. ii, 294 Hdfar Abi 

Müsä. 

el-hdgü bedeutet bei den Gahtdn blos die Taille; der lange 
Leibriemen wird bei ihnen e-sibte genannt. Andere Stämme 
nennen ihn el-hageb. 

589. el-Hegndwl ist die corrccte Form gegen Wetzstein, der HeJcnowl 
schreibt. 

590. Cinder-hill heisst Ü-halä pl. el-hell oder el-heliän. 

Die dabb -Eidechse wird auch Obü Hdmed üder Obü Alymed 
genannt. 

el-hamdde ,die Kieswüste' ist ohne TeSdid zu schreiben. 

Hammam ,the purse' ist offenbar ein Schreibfehler für hemjdn 
(^U^-ä persisch ,Beutel') 



T3 






T3 



O o 



(T3 



= 1 

F P. 



u 



.E -ö 
-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 53 

592. el-Harig resp. el-Haridz grösserer Ort im NW. von el-Hota. 

593. Hdrrat KüSüb ohne Artikel. Auch Huber 735 sehreibt un- 
richtig harr ah El-Qe5eb. 

Statt Harrat Turra lies Hdrrat e-fardh. Bei Kiepert Nil- 
länder fälschlich Harrat el-Turra' (Jac. iii, 521). 

el'hdH pl. el-heSwdn einjähriges Kamel, synonym mit el-mafrüd, 
die Angabe Dozy S. i, 292 ist unrichtig. 

594. Hddn wird gesagt ohne (jrebel für J. Hatthon. 1 
Lies el-Höta statt Hanta. Es giebt ein Hötat Beul Temim, 

das bekannte el-Hota und ein Hötat e Sder. Letzteres auf Kiepert's 
Karte irrthümlich Hüla geschrieben. 

595. el-lßzdm pl. el-hizm der Gürtel. 
el-hdzm pl. el-hSzüm oder el-hezmdn ist eine mit grossen Kieseln 

übersäte Ebene. 

el-Hdzzam ist Hdzm Sehdn Huber 732, 733. 

Lies Hezem e-Sed Huber 736 (Kiepert, Nilländer fehlerhaft 
Hazeim e-Sejid. 

Lies el-Hünäkije nicht el-Henakie wie Kiepert Nilländer schreibt. 

596. Lies el-heüSüll plural el-henSel, mit Nasalierung des n, , Wüsten- 
räuber'. 2 

598. Lies Hremle, bei Kiepert Horeimele. 
600. Lies el-hazz ,das Glück'. 

el-hwdr pl. el-lßrdn ist der Name für ein ganz kleines Kamel, 
das das erste Jahr noch nicht erreicht hat. Die den verschie* 

° E 

denen Jahren entsprechenden Kamelnamen sind folgende bei den 
Gahtdn : 

el-hwdr plur. el-herdn vor dem 1. Jahre. 

el-mafrud plur. el-mefärid von dem 1. bis zum 2. Jahre. 

el-Jiedzdz plur. el-hidzdzdn von dem 2. bis zum 3. Jahre. 

el-lidzl plur. el-lidzjdn von dem 3. bis zum 4. Jahre. 



■ö 






w i 

fN CO 

° m 



_N 
'-I-J 
'Ol 



w 



1 In allen Karten und Reisewerken findet man vor jedem Bergnamen Gebet. 
Dies ist sehr häufig unrichtig. So sagt man wohl Twedz oder Dila Tw&dz, nie- 



mals aber Gibel Twedz, ebenso Hazäz, HiltU stets ohne Gebet. 

2 n wird im Gahtandialect vor i stets nasaliert. 

. .. 

-ö v 
E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



54 J. J. Hess. 

el-gida plur. el-gid'dn von dem 4. bis zum 5. Jahre. 

6-tinl plur. e-tinjdn von dem 5. bis zum 6. Jahre. 

e-reba plur. e-reVdn von dem 6. bis zum 7. Jahre. 

e-sedis plur. esidsdn von dem 7. bis zum 8. Jahre. 
Da diese Liste von der Burkhardt's bedeutend abweicht, so be- 
merke ich, dass die drei letzten Namen vom Hervorstossen der 
Zähne genommen sind. B. irrt, wenn er glaubt, e-tinl bedeute ein 
Kamel, das zwei Mal geboren habe und e-rebd* eines, das vier 
Jahre alt sei. Ebenso ist el-mShaltil nicht ein Altersname, sondern 
bedeutet ein Kamel, dem behufs Entwöhnung ein spitzes Stück 
Holz (el-hläl plur. l-ahille) durch die Nase gezogen ist. 

601. Statt humsis hörte ich el-Iiambesis, 
Statt humth hdmd lies also Wddl l-Hdmd. 
el-hddbe plur. el-h^ddb bezeichnet einen dunkelrothen, mit Geröll 

bedeckten, konischen Hügel oder Berg. Die hddbe ist nicht so 
schlank wie die gare und kuppenförmig, während die gare oben 
ein kleines Plateau hat. 

602. l-idml plur. l-idm wurde mir beschrieben als Gazelle mit grössern 
Hörnern als die andern Arten. Die Farbe sei dhmar dzrag, also 
ungefähr wie die r efrl 9 aber am Bauche und an den Hinterbeinen 
weiss. 

606. Bei den Galitdn heisst der ,bone setter' el-megebber. 
Jaddar ist falsch, im Text steht richtig jadda* lies el-gddde 

plur. el-guwddd. Auf den grossen Karawanenstrassen findet man 
eine Reihe von einzelnen nebeneinander laufenden Wegen von 
etwa 40 cm. Breite. Sie sind von Kamelen ausgetreten worden 
und sehr geschlängelt, es sieht also eine Karawanenstrasse so 
aus ^^^^- Diese einzelnen Wege heissen güwddd. 

Gdn ist singular wie im Altarabischen, el-ginn ist collectiv. 

Statt Jdrada lies el-Gerede. Dies ist in der Nähe von e-Rass, 
aber weit von l-^tle. 

607. Beil heisst el-geddüm plur. el-gedädim bei den Gfahtdn* in Kairo 
hört man auch gadüm. 

Statt Jehemaa lies el-gihme. 



CÜ 



t! öi 



Cl 



03 



<=> o 

c v> 
o E 

^-^ 4-1 

TD ±3 

§ i 

- "r? 

£ ö. 

P 

U 

«4- ~° 

- O) 
_N 
'-I-J 

> <u 

c 

— o 

.E -ö 
-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 55 

608. el-Gerefe ist nicht in el-Gasim, sondern im Batin, d. h. zwischen 
el-Wesm und e Sder. 

el-geride ist der Palmenzweig, aus dem man dann allerdings 
Wurfspiesse machen kann. 

Statt jerula lies el-gerwel plur. el-gerdwil, das ist die Blöcke 
und der Schutt, den der S61 ausgräbt und mit sich reisst. 

609. el-dzett. 

Für jidda ist sicher el-dzidr plur. el-gdür zu lesen. 

el-giddr plur. el-gidrän heisst bei den Gahtdn , Mauer; hier 
scheint die Bedeutung freilich nicht zu passen. 

el-dzedihe ist nicht ,milk basin', sondern ein Instrument von 

dieser Form O , das in die Milch getaucht und zwischen den 

beiden Handflächen gedreht wird um Butter zu machen. Das 
hölzerne Milchgefäss heisst el-dzedäh plur. el-dzedhän. 
611. el-Kahtdn mit Artikel ist unrichtig. Der Stamm heisst nach 
seiner eigenen Aussprache Gfyatdn, sing. Gehatdni, plur. el-Gahätin. 

el-gaar plur. ehgu'ür ist ein grösseres Loch oder Vertiefung in 

der Erde und hat nicht nur den speciellen Sinn, den ihm Euting 

* 

i, 144 und Huber, Journal öl, 568 geben. 

_ in 

Statt el'Kamim lies el-Atsämim, Huber 736 schreibt ebenfalls 

TT) hj 

unrichtig d-Akämvm. 

Statt Kasr Hajelldn lies Gasr 'Agldn. 

Statt Kassab lies el-Gasab; dies liegt im el-Batin und nicht in 
el-Ga&m. 
614. Lies Hazdz statt Kezaz, vgl. Huber 713, 714. 

Lies el-Hdrg statt Khark oder el-Khark (Kiepert). 

el-Kherj ist identisch mit dem obigen. Die Orte, die D. hier 
anführt, lauten nach meinen Erkundigungen (von Hesen vom 
Stamme der Beul Temim aus el-H6ta): e-Selem, el-Jemäme, Na- 
*gdn e-Slemije, el -' Oddr (vielleicht mit d), e~Seh. 

616. el'hüstvl plur. el-hasdwie lies statt el-Khossi. 
Hddra ist ein Frauenname. 

617. Der Gefährte heisst el-huwl plur. el-hwuja. Mit Suffix huwijl 



w i 

fN CO 

O u 



f 10 - 

O o 

c w 

o E 



(T3 



$ 5 



F P. 



u 

O <L> 
CT 



o 



huwijek huwije. 

c -o 



E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



56 J. J. Hess. 

Lies el-Hdbra *\^Xi.l statt Khubbera. 

el-Hwere ist nom. propr. und Diminut. von el-houivära pl. el-ha- 
wäwir eine Art kleiner, viel Milch gebender Kamele. 

Statt khüsa lies el-hüsa ,das Messer', bei den Gahtän sagt man 
dafür e-sdfra plur. e-Sfdr. 

el-gedemije plur. el-güdemljät heisst gekrümmter Dolch. 

el-dzirwe. Bei den Gahtän macht man aus Weizenmehl einen 
Teig, über diesen liest der metöuwa [d. h. der figl der Aegypter] 
geh eimniss volle Verse. Dann wird der Teig in ein Stück Leder 
gebunden und an den Hals gehängt. 

Zu Koba. Das alte Kuba hat D. auf seiner Karte verzeichnet 
ohne es zu wissen. Statt Akaba am Rande der Hdrrat Küsüb 
ist nämlich zu lesen Ugbe d. i. ^ Jac. iv, 24. 

el-Gunselije liegt, wie mir von einem Gahtänl mitgetheilt wurde, 
nicht im Wddl Sbe r , sondern im Wddl Trübe. 

Die Karawane el-gdß plur. el-güfül heisst bei den Gahtän el- 
medid plur. l-imidda. 
619. Statt Kuruniyah lies el-Grenije ,die Bewohner von 'Aleije'. 

el-Kwet ,die kleine Festung' (hindustanisch) heisst der Ort. 
Kiepert schreibt unrichtig Kueit, wohl nach türkischer Ortho- 
graphie. Der auf allen Karten sich findende Name Korein dieser 
Stadt ist keinem Araber bekannt. Vielleicht verdankt er einem 
Missverständniss oder Verwechslung sein Dasein; nicht weit von 
el-Kwet ist nämlich ,a creek named Grain which leads to the sea' 
Journ. of the R. Geogr. Soc. 1865 p. 170, die Bay von el-Kwet 
,is also called Gurn or hörn in allusion to the shape of the bay'. 
622. masub ist wohl bloss partic. pass. Das 'ogäl heisst bei den 
Duxcäsir el-asäbe pl. el-asäjib. 

Der Emir von Berede heisst Mehenne. 
625. Ein plötzlicher Windstoss, resp. Staubwolke heisst el-masär 

■4-J .t^ 

plur. el-ma'äsir. 

Masul es-Sudda in a seyl bed under Jebel Shotb p. 521 zeigt, 



t! öi 



w I 

fN «/> 

° m 



o E 



(T3 



2 5 



F P. 



u 

«4- ~° 



\v =? 
> <u 

=) O 

— o 

dass D. nicht vollständig in's Verständniss des Arabischen ein- 
gedrungen war. Der Ort heisst Mäsil el-Gimh d. i. das J-?^* 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 4J 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 57 

J^ des Hamdäni [richtig punktiert? die heutige Aussprache 
lässt dies bezweifeln] und liegt in einer tiefen Schlucht (arabisch 
e-sdd r pl. e-sed'dn oder e-sdtb plur. e-ätdbe). Mdsil ist übrigens nicht 
im Twedz wie D. sagt, sondern W. vom el-£rd etwa zwei Tage 
westlich von el-Gw&ije. 

Der genauere Sinn von el-matije plur. el-matdje wurde mir wie 
folgt angegeben. Wenn man in der Ferne ein Kamel erblickt, 
sei es Reitkamel oder nicht, beritten oder nicht, so sagt man 
'ajint matije, ebenso wenn man nicht unterscheiden kann, ob es 
Pferd oder Kamel ist. Das Wort hat also eine viel allgemeinere 
Bedeutung als D. angiebt. 

el-maded plur. el-mddfäd nicht m'athüd ist die Spange, die die 
Beduinenweiber am Oberarm tragen. 

627. Statt Mehäditha lies el-Mähdite vgl. Huber 741 (Jac. iv, 424 
ident.?). 

628. Von den Orten, die D. als zu el-Mehmel gehörig bezeichnet, ist 
mir es-Sifßlly nie zu Ohren gekommen, die übrigen lauten in 
Wirklichkeit: Tddidz (JJ^*, Kiepert ungenau Sddik), e-Sf errat 
wel-Bir, 'Aletje, el-Wdsta, el-Bdrra oder Gasr el-Bdrra (bei 
Sadlier el-Burro), Utetie, Heremle, Südüs (ohne Te§did). 

629. Lies el-Merdime. 
Lies Mergab e-Rdfe. 

Für MeShed 'All sagen die Araber auch e-Seijid. 
Lies Meter statt Meteyr sing. el-Meterl. 

630. Lies Metellete. 



ö. 2> 



w i 

fN CO 

o y 



o E 



(T3 



Schön von einer Frau gesagt heisst mezjüne nicht mesüne. 
Midda als Lösegeld habe ich nie gehört, wohl aber e-dje vom 



F P. 



634. Statt el-Monasir lies el-Menäsir sing. el-Mansürl. 



Verbum widä impf, jddl ,das Wergeid zahlen*. 

631. el-Midnib ist nicht in e Sderl sondern am Ende des Wäd' e-Sirr. 

632. el-medzil ist der Ort der Mittagsrast, el-medzeijil ,der die Mittags- 
rast haltende*. 

=) o 

— o 

CO 

636. el-Mudidz bei den iZa-ri el-Mudiq Jac. iv, 560. 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



58 J. J. Hess. 

Statt el-Moy hörte ich el-Muäh von den 'Ötebe, el-Mueh von 
den Ga(itdn. Vergl. Huber 736. 
Für Mudowwy lies el-meddici, 

637. Die Finde el-Müguta sing. el-Migdti gehört zur Gruppe der 
Bdrga. 

Die Milchstrasse heisst bei den Gahtdn el-migar. 

Zu el-mindel wird wohl ein Wort zu ergänzen sein; wie ddrib 
el-mendel (cf. Dozy, Supp. 653, Lane, Mod. AegypL, Deutsche 
Ausgabe n, 91). Bei den Gahtdn bezeichnet el-mendel ,die Diebe* 
(collectiv) und zwar heimliche Diebe. 

Man sagt immer AI Mörra. 

638. Nicht Muttoivw'a, lies el-metöuwa' plur. el-metdwa* ohne Teädid 
des t, wörtlich ,der Gott unterworfene*. 

640. e-Nebhänije mit Artikel! 
e-nifd bedeutet nicht Düne, sondern etwa ,Dünenmeer*. Von 

einem 'Agaml wurde mir das RüV el-Häli hinter Jebrin be- 
zeichnet als nifd wd'ar. 

641. Statt Nefur et-Jarifc hörte ich von einem 'Otebl Ndfrat Jaridz] 
e-ndfra wurde mir als alleinstehender Berg erklärt. 

Statt nenhask lies nenhag. Das Verbum ndhag ist bei den 
nördlichen Stämmen, aber nicht bei den Gahtdn im Gebrauch. 

642. e-nsrme heisst wohl nur der Hauch und nicht ,a breathing wile'. 
Der Satz, den D. ii, 97 giebt, lautete arabisch wohl üg'ud ja seh 



ö öi 



T3 



03 

Halil tenessem. tenessem itenessem bedeutet schnaufen und ver- 



weilen. 

Statt e-nügra plur. e-ngar wird bei den Gahtdn für eine Ver- 
tiefung besonders in eVÜrd el-güfra plur. el-gifar gesagt. 

Wegfliehen, wegziehen (vor einer Gefahr) heisst hegg jehigg. 
Lies also enhigg statt nuhej oder <^. 

Statt N'kussha lies e-Nekü§e sing. e-NkeSl. 
643. örga ist imperativ ,nimm, leck den Rahm' (e-rögwe). 

Osheyjir ist Uäedzir. Da Sdgra und ÜSedzir ganz nahe bei- 
sammen sind und oft zusammen genannt werden, kommt es, dass 
für letzteren Ort bei D. auch die corrupte Form Shujjer vorkommt. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



F p. 



u 

«4- ~° 

O <L> 

CT 



=> O 

— o 



ti öi 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 59 

644. Otheythia und Oiosheyfy sind beide = Utetie. 
el- r Oäezije ist doch einfach von el-6§ez y eine Baumart, die ich 

nicht näher bestimmen kann. 

645. The pincers worn by the Bed. housewives heissen el-mingäs 
plur. menädziS. 

647. Lies e-redif plur. e-rdife ; e-rafidz plur. e-rfiga und e-rdfdl 
plur. e-rfüde. 

648. e-ruhül plur. e-rühl bezeichnet ein weibliches Lastkamel. 
Der Regenbogen heisst bei den Gahtdn e-tenhime oder hutt 

ene'me. 

eriml plur. e-rim bezeichnet wie im Altarabischen eine weisse 
Gazelle ,die beste der Gazellenarten c . 

652. Statt W. Rissha lies Wdd y e-R§a das alte Wddl ar-Rüa. 

653. Für e-Rukka wurde mir e-Ruka gesagt (Jac. ii, 808). Die 
Identification Sprengers mit £Ü»pi ^U^> ZDMG. 1888 331 ist also 
nicht richtig. 

Lies Rükbe statt er-Rukkaba. Auch Huber schreibt den Namen 
unrichtig Rqoubeh (<^>) S. 738. Vgl. Jac. ii, 809. 

Statt Runnya etc. lies Rdnje. Auf Kieperts Nilländer steht 
unrichtig Ghanie. 

e-riss plur. e-rsüs wurde mir definiert als Brunnen in gebirgigem 
Gelände mit wenig Wasser. Der Name der Stadt J!*^\ wird 
stets d-Rass oder e-Rass gesprochen, es scheint mir daher zweifel- 
haft, ob er von e-rüs abgeleitet ist. 

Statt er-Ruthdn lies er-Rüsdn sing. e-Rwesi. 

Für unsalted sagen die Gahtdn sämig. 

658. e-sefar ist nicht ,the rising of the sun', sondern die Zeit vor 
dem Sonnenaufgang, in der es schon hell ist, daher auch sefar 
e-sübh genannt. 

Statt Seffua lies Sfuwdt vgl. Hüber 732. 
Semila hat nichts mit a1**j zu thun, sondern ist das klassische 
J^Jl Tag el-'Arüs vn 407. Es lautet bei den Gahtdn e-semil 
plur. e-sumldn. 

659. Nicht Sh'aara sondern e-&'dra mit Artikel lautet dieser Name. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Cl 



03 



F p. 



u 



60 J. J. Hess. 

660. Statt Shdba lies Se'dbe; das ^j?*^ des Hamdäni cf. Jac. iii, 293. 
es-Sheab ist S?b el-Dzidd, nicht weit von Tühfa. 
J. She'aba ist wohl e-SVb oder besser Sib el-'Äsibijdt, bei 

Hüber 727 El-&äb. Es wäre dann ähnlich wie Umm el-Meiaib 
an die falsche Stelle gerathen. 1 

Zu Sh'aeb ist zu bemerken, dass D. zwei Wörter zusammen- 
geworfen hat. e-$tb plur. e-Seäbe und e-$eib plur. e-Sä'bän. Vgl. 
Hüber 118. 

Statt es-Sheabin lies e-J§ijabin sing, e-ßeibänl vgl. S. 662. 

Sebrüm ist unrichtig. Es giebt ein Waefä e-Sübrum und eine 
hamäde e-Subrurntje (vergl. Huber 727, 728). Beide Namen sind 
abgeleitet von e-Sübrum, eine Baumart, Euphorbia Pityusa nach 
Dozy Supp. 

661. e-selfe bezeichnet nicht die Lanze und ist daher nicht synonym 
mit e-rumh, sondern die eiserne Lanzenspitze, sofern sie breit 
d. h. schneidenartig ist. Die runde Lanzenspitze heisst el-hdrbe, 
das Eisen am untern Ende der Lanze el-*akküz, bei einigen 
Stämmen el-guntär (bei Burkhardt fälschlich kentad). 

e-omäsije ist zu lesen. 

e-senne plur. e-Sendn bezeichnet bei den Gahtdn eine alte ver- 
brauchte girbe wie im klassischen Arabisch. 

662. e-Sibibije heisst die erste Station auf der Strasse 'Aneze- Mekka. 
Statt es-SJihebba lies e-Shdbe sing. e-8hebi. 

663. Statt Shinäny lies e-Snäne. 
Dass Araber das persische y^> für Kamel gebrauchen, er- 

scheint mir recht zweifelhaft. Hier wird wohl das Wort l-estar 
fem. e-Säträ plur. e-Sütr ,Kamel mit kurzem Schwänze' vorliegen. 

Statt Sh'kdky lies Skdke (= Sukdkah Jac. iii, 106). 

e-Sdtb plur. e-Stdbe ,die Schlucht'. 

J. Shotb siehe oben S. 57, es-Showfig S. 48. 



t! öi 



w I 

fN «/) 

f\l ^ 

, O) 

° £ 

O o 

c w 

o 5 



§ S 



F P. 



u 



664. e-Sümt, bei einigen e-süm ist ein dicker Stock aus Rohr. 

1 Das «/. JShayb der Karte D.'s und Kieperts ZJ;. e -Schafft entspricht in 



Statt Shuggera lies Sdgra -^aä. 

=) o 

— o 

c O 

£ aj 

Lage genau dem Si*b el -Äsibijät. 

£ -o 
-0 v 

E-e 

E => 
ro <u 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zu Doughty's Travels in Arabia Deserta. 61 

Statt Shurrma lies Sürme. 

Die Orte, die als zu Sder (auch ^Sder aber nicht e-Seder) ge- 
hörig angeftihrt werden, heissen 'Ääere, e-Zilfl, ü -'Agal, e-Tmeile, 
el-Gdt, el'Hi8 9 e-Ruwede, el-MegmcCa, Härme, Gwei, Geläßil, e- 
Ddhle, e-Twem, el-Öd, Rödat 'Sder, el-Attdr el-Ode, Tmer, 
Hötat € Sder. 

Statt sillima lies e-slime collectiv e-selem. 

666. Die Schleuder heisst bei den Gahtdn el-menddfe plur. el-manädif, 
bei andern el-mergdme plur. el-merägim. 

667. Statt Solubba lies sing. e-Slübi plur. e-Slube. 

668. Sotwh ist unrichtig. Die Schwertwunde heisst z. B. bei den Meter 
und 'Otebe e-sdfwe, die Gahtdn sagen dafür el-f iL 

Zu s<f bilden die Gahtdn den plur. e-sedn. 

669. esdnie plur. e-$au?am wurde mir erklärt als das Kamel, das 
das Wasser alis einen Brunnen schöpft. 

Dass es-Suedda eine Abtheilung der Gahtdn und Bewohner 

Sdgra's sind, ist wohl unrichtig. e-Swide sing. e-Sioedi wurde mir 

als eine Finde der 'Ötebe genannt. Eine Finde der Gahtdn heisst 

dl e-Sweddn sing. e-Sweddni, ist aber nicht in Sdgra sesshaft. 

671. Bei den Galitdn ist e-th^dl ,die Milz' und ,eine Milzkrankheit 

der Schafe'. 

e4d*8 pl. e-to'üs diminutiv e-tä'es, altarab. o***? und ^>. 

6 75. Statt thalük lies e-tö'lüge. 

Than-ak ist natürlich &£?«>, beduinisch dandk. 

Statt Thennyib lies e-Dendjib. 
"ö £ 

Die heutige Aussprache von Ij^j ist Tdrmede. 

676. Theyd(k)ch auf den KiEPERT'schen Karten Sddik, bei Pelly 
Tadij ist Tddids JJjU*. 

Für JÄo& lies 6-$abb plur. e-dubbdn y für Thobby e-ddbl plur. e-dba. 

677. Du-Itbet sing. eLItbetl] Du Izjdd sing. e-Zijädi. 
6-zuma ,der Durst'. 
Statt JTiurbän lies e-zrimbdn plur. e-zaräbin. Er wurde mir 

geschildert als von der Grösse einer Katze, bräunlich, isst den 



F P. 



u 

«4- "° 

O <L> 



CD 
> <U 

c 
— o 



Jafefe; es ist also wohl der Iltis. 



.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



62 J. J. Hess. Bemerkungen zu Doughty's Travels etc. 

678. Die Erzählung von einem wilden Kamel, das nur sechs Rippen 
hat, wurde auch mir oft wiederholt, aber alle Beduinen nannten 
es el-hitt plur. el-hejäta, nur einmal hörte ich von einem Städter 
e-tihl. 

J. Tobey(k)ch, bei Kiepert Tobeit, ist e Tbeidz Huber 573 (viel- 
leicht mit Artikel?). 

679. Statt J. Tufyk lies Twedz oder Dila Twedz. 

680. Die Beduinenaussprache von ÄJy ist Trübe. 

681. Statt J. Ummry lies Amre. 

682. Für el-Urruk lies el-ärige. 
el-Uthüb wird von den Gahtdn genannt el-jiteb (mit^ wie Berti 

Jiklibe = *^S\ ^o). 

el'Wdber pl. el-wubäre ist der Klippschliefer. 

687. el'ivudehl plur. el-wudehljdt. 
Statt Wurrür lies el-waral plur. el-wuräle. 

688. Eine Form Ybba habe ich nie gehört; die Beduinen sagen obu, 
z. B. obu hd§m 7 grossnasig', obül ,mein Vater'. 

Die Eule heisst el-gSbese plur. el-gbesdt mit ^ trotz Bokhtor 
und Dozy Supp. ii, 299. 
690. e-zmdm ist bei den Gahtdn ein silberner Zierrat, den die Frauen 
am Haare vorne beim Gesicht befestigen, diminutiv e-zmejim. 
Der Nasenring heisst bei ihnen el-färde. 

689. Statt zelamat lies e-zlime plur. e-zilm (nicht gahtänisch). 



ti öi 



w i 

fN CO 

f\l ^ 

, O) 

o y 

O o 

c w 

o 5 



(T3 



$ 5 



F P. 



Nachtrag. 

513. Donnebil ist kein nom. propr., sondern dane'bil (J*?\ *£?**) , Junge 
von Kamelen', enthält also dasselbe Wort e-dana, das S. 675 mit 
oWj erklärt und von Socin, Diwan S. 286 irrthümlich als Be- 
zeichnung des einjährigen Kameles ausgegeben wird. 

«4- ~° 

O <L> 

*S 

'i/i öi 

ä ■? 

> cu 

C CT 

=) o 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



CÜ 



t! öi 



Erklärung einer Veda-Stelle. 

Von 

Julius von Negelein. 

Ich gehe von der wichtigen und vielumstrittenen Stelle V. S. 
23, 18 = MS 3, 12, 20 aus, cf. Zimmer AL. 36, Oppert, Bharata- 
varsa 619. Der Text lautet: Ambe ambike 'mbälike na mä nayati 
kaqcana, sasatyagvakah subhadrikäm kämpilaväsinim. Die Haupt- 
schwierigkeit des Verses liegt in den ersten drei Worten. Weber, 
Litt. 2 , 126, Ind. Stud. 1, 183 cf. 5, 51 stellt die Behauptung auf, 
dass zwischen der Mahisi, die dem Stamm der Kurus angehörte und 
der in Kämplla wohnenden also den Pancäläs zugehörigen Subhadrä 

Q. 

ein feindliches Verhältnis bestand. Danach wären die Worte der 
Grosskönigin als ein Seitenhieb auf die Concurrentin anzusehen. 
Die Worte lauten in Webers Uebersetzung : ,0 Ambä, Ambikä, o 
Ambälikä, mich führt Niemand (mit Gewalt zu dem Pferde): (gehe 
ich aber nicht, so) beschläft das (böse) Pferd (eine andere wie) die 
(böse) Subhadrä die in Kämpila wohnt/ Zugleich macht Weber 
darauf aufmerksam, dass die drei Vocative sich im Epos als Nomina 
propria und zwar als Namen der drei Töchter eines Königs von Kägl 
wiederfinden, der die Mädchen an einen Vicitravlrya verheiratet, der 
sich mit ihnen zusammen totamüsiert. An die vorerwähnte That- 
sache knüpft Weber weitere Combinationen über das persönliche 



O o 



F P. 



u 



'i/i öi 

"* CD 

Verhältnis der Mahisi zu diesen drei Frauen. Nun denke man sich 



3 ^ 
O 



ein Weib in der geschilderten verfänglichen Situation, mit einem 



5 S 



toten Hengst den (symbolischen) Beischlaf vollziehend, zugleich aber 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






64 Julius v. Negelbin. 

Verse auf ihre Nebenbuhlerinnen extemporierend; denke sich ferner 
diese Verse aus einem (noch nicht ersichtlichen) Grunde der Nach- 
welt aufbewahrt und zum typischen Bestandtheil des Opfers erhoben, 
um die Glaubwürdigkeit der WEBER'schen Uebersetzung beurtheilen 
zu können, die nicht nur, wie Zimmer AL. 36 bemerkt, alles Wesent- 
liche, worauf seine Deutung sich stützt, ergänzt, sondern den ganzen 
Vers in einzelne Worte zerpflückt, die den von ihm ergänzten Halb- 
sätzen gegenüber ziemlich überflüssig sind. Nun werden ferner auch 
die Töchter eines Kosala-Herrn mit den Namen Ambikä und Ambä- 
likä belegt, sodass der specielle epische Bezug der WEBER'schen 
Hypothese dadurch fraglich wird; s. Pet. Wörterb. Völlig unmöglich 
aber wird seine Uebersetzung durch die in drei Texten des schwarzen 
Yajus überlieferte Variante (Tait. S. 7, 4, 19, 1, Käth. A9V. 4, 8 Tait. 
Br. 3, 9, 5, 1 — 13): Ambe ambälyambike y na mä nayati kagcana \, 
sasasty agvakah \ subhage kämpllaväsini suvarge loke sarhprornväthäm \ 
u. s. w. Auffällig ist es, dass diese Texte das Versmass völlig zer- 
rissen haben. Sie haben das volksthümliche Metrum als solches 
nicht mehr gefühlt und verstanden. Von entscheidender Wichtigkeit 
aber ist die Variante der ersten drei Worte ambäly ambike statt am- 
bike "mbälike. Es handelt sich also offenbar nicht um die Anrufung 
zeitgenössischer Königstöchter von Seiten der Grosskönigin, sondern 
weiblicher Genien, in deren Namen der Begriff des Weiblichen, 
Mütterlichen, durch die Nominalbildung variiert, zum klaren Aus- 
druck kommt. Ich sehe in den genannten Worten Bezeichnungen 
einer bestimmten Classe von Nymphen in ihrer Function als Zeugungs- 
gottheiten und in der den volksthümlichen Versen eignen, der 
vedischen Speculation entfremdeten Auffassung. Dass das Epos — 
die vorerwähnte Strophe ist epischer Natur, denn sie trägt den 
Gäthä-Charakter — in seiner populären erstgeschaffenen Form Be- 
griff und Namen der Apsaras bewahrt hat, wo der Veda diese ihm 
so unbequemen Figuren ganz bei Seite zu schieben oder theologisch 
umzuwandeln suchte, dass ferner das Mahäbhärata die alten volks- 
thümlichen Nymphenerscheinungen mit zunehmender brahmanischer 
Superredaction stets mehr und mehr ihres ursprünglichen Charakters 

.E "ö 

E-e 

E =3 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

fN CO 

, O) 

O u 



O o 

c v> 
o E 



(T3 



> I 
F P. 



u 

O <L> 

CT 



Erklärung einer Veda-Stelle. 65 

bis zur völligen Unkenntlichkeit entkleidet hat 1 — darauf hat bereits 
Holtzmann im 33. Bande der ZDMG. (s. S. 641) hingewiesen. Den 
allgemeinen Standpunkt giebt er treffend, wenn er ibid. 644 sagt: 
,Es wird auch hier wieder deutlich, dass das Epos sich, wie eine 
eigne Sprache, so auch eine eigne Mythologie schuf, eine anthro- 
pomorphische, zu der sie das Material allerdings aus der älteren, 
die Naturkräfte symbolisierenden Mythologie bezog, aber dasselbe frei 
nach ihren Kräften umgestaltete/ Zu diesen Anthropomorphismen des 
Volksglaubens gehören nun in erster Linie offenbar die Apsaras, 
die,wie bekannt, im IJgveda nur einmal, und zwar im zehnten Buche, 
in einem Vasistha-Liede, erwähnt werden, obgleich Kuhn, Herab- 
lcunft des Feuers und Göttertrankes, nicht nur ihre mythischen 
Figuren, sondern auch ihre typischen Bezüge zu Helden u. s. w. als 
indogermanisches Gemeingut erwiesen hat. Was wir von den Apsaras 
aus späteren Texten wissen, verdanken wir meist dem bekanntlich 
populär gehaltenen Atharvaveda. In dem purasamedha der Väja- 
saneyi-Samhita wird ein vrätya den Gandharven und Apsaras ge- 
weiht. Auch daraus scheint eine gewisse Zugehörigkeit der noch 

ü g 

nicht brahmanisierten Stämme zum Kult der volksthümlichen Götter 

i- g 

zu erhellen. In diesen Kreis gehören auch alle Sagen, die von der 

01 ^ fr • 

Vereinigung von Nymphen mit Helden reden. Das Agastya-Motiv 
ist für diese Gruppe das Prototyp. Varuna, der alte Wassergott, muss 
der Vater der Nymphen im Volksglauben gewesen sein, wie er sich 
noch im Brahmanismus als Herr der spontanen Zeugung, des spontan 
sich entwickelnden Lebens, erhalten hat. Der erwähnten Mythe liegt 
der Sinn zu Grunde, dass ein alter Nacht- und Wasserriese im Verein 
mit dem strahlenden Tagesgott — beide werden monistisch zu einer 
Figur zusammengeschmolzen — den lebenerweckenden Samen in 
die Wasser gegossen haben, die diesen, glücklicher als der Mensch, 
ohne den Schutz des tragenden Mutterleibs zur Reife zu bringen im 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



F P. 



u 

«4- ~° 

O <L> 

*S 

'i/i öi 

ä -? 

■- ^ 

1 Der Brahmanisierung der Apsaras-Auffassung steht in der deutschen Lit- 
teratur ein interessantes Pendant gegenüber. Praetorius, Anthropodemus pluto- 
nicus i, 463 sagt: ,Aber damit du dich noch weniger wegen der Tri tonen ver- 
wunderst, so sollstu wissen, dass es auch Mönche und Bischoffe im Meer seyn.' 
Wiener Zeitschrift f. d. Kunde d. Morgenl. XVI. Bd. 5 

o "E 
E => 

to _c 
in +j 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 

ü Q_ 



Original fronn 






(T3 



2 5 



03 



fU 



66 Julius v. Negelein. 

Stande sind. 1 Solche Mythenansätze haben ein durchaus volkstüm- 
liches Gepräge, Zeigen sie doch die vom Brahmanismus zu solaren 



1 Dass man speciell in Varuna und Mitra diese Funktion verehrte, lehrt 
folgende Stelle: nach KQS 15, 4, 10 — 13 gehört ein caru von rothera Reis dem Indra 
jyestha, ein caru von wildem Weizen dem Kudra pacupati, ein solcher von selbst- 
gewachsenem d. h. spontan entstandenem Weizen dem Mitra satya, einer von 
Gerste dem Varuna. Nach QB 5, 3, 3, 8 gehören diejenigen Gewächse, welche 
der Aussaat bedürfen, dem Varuna zu, die spontan entstehenden (nämbäh) aber 
dem Mitra. Die Beziehung, die jenes Götterpaar zu der Welt des Lebens hat, ist 
also uralt; sie bringen den Keim von Mensch und Pflanze un ausgetragen zur 
Reife. Die Idee, dass aus dem Samen von Mensch und Thier Pflanzenwesen her- 
vorspriessen, ist weitverbreitet; der Himmelsgott, im Veda auch Parjanya, lässt 
seinen lebenerweckenden Samen auf die Erde fallen, der (Himmels-) Stier spritzt 
seinen Samen auf die Erde, nach deutschem Aberglauben (s. Wuttke, Aberglaube) 
erwächst aus dem niedergefallenen Samen eines Erbdiebs eine wunderkräftige 
Pflanze, nach Grimm, Wörterbuch, ist ,Pferdesamen' = Pferde-Fenchel, Nemnich 2, 
942, also offenbar ein aus dem Hengst-Samen entstandenes Kraut. Auf die specielle 
Fortentwicklung dieser Idee auf indischem Boden gedenken wir alsbald in dem Auf- 
satz ,Zur Kenntniss der altindischen Volkspoesie', in dieser Zeitschrift aufmerksam 
zu machen. Die Schale ersetzt hier gewissermassen als Retorte den natürlichen 
Mutterleib. Daher heisst nicht nur Agastya, sondern auch eine Pflanze und eine 

Apsaras: Kumbhayoni ,deren Mutterleib ein Gefass ist*. Zu der gebrachten Ana- 
i— ^ 

logie mit dem Eierlegen der Fisch- und Vogel-Nymphen kommt noch das Beispiel 

von der Leda, die in Schwanengestalt mit Zeus zwei Eier zeugt (s. z. B. Basttan, 
Zeitschr. f. Ethnol. 21, 121) und von Nemesis, die nach Pausanias 1, 33, 7 (s. ibid. 
27, 347) ebenfalls ein Ei gelegt haben soll. Nach einer birmanischen Sage legt 
eine Naga-ma (ein Drache), der die Gestalt eines schönen Weibes angenommen 
hatte, zwei Eier, aus denen zwei Knaben erstehen (Seidel, Asiatische Volkslitteratur 
235 f.). Nirgend kann sich glänzender als hier die Thatsache zeigen, die sich 
eigentlich der modernen Forschung von selbst verstehen sollte, dass die Verwand- 
lungen der Mythenwesen nicht freie Phantasieproducte, sondern Rückschläge zu 
mythengeschichtlich älteren Existenzformen sind. Ich habe sie als Atavismen 
bezeichnet. Noch erwähne ich als zugehörig folgende Beispiele: Hygin fab. 197 
erzählt, ,es fiel vom Himmel ein ungeheures Ei in den Euphrat; Fische wälzten es 

an das Ufer, Tauben brüteten es aus und es ging die Venus daraus hervor, die 
o v 

später die dea Syria genannt wurde. Daher die Syrer auch Fische und Tauben 

für heilig halten und nicht essen 4 . (Hier fällt die richtige Begründung des tote- 

mistischen Speiseverbots auf.) Zu den Wassernymphen, die ihre Kinder verlassen 

resp. töten, gehört auch die Gangä, die ihre sämmtlichen Leibesfrüchte in den 

Fluss wirft: Mahab. 1, 3888 ff. Wieweit die Sage von der Geburt des Dionys in 



diesen Kreis gehört, soll dahingestellt bleiben. Er ist die unausgetragene Frucht 

C -o 

-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 
O Q_ 



Original fronn 









Erklärung einer Veda-Stelle. 67 

Wesen verflüchtigten Figuren der beiden Götter recht nach Menschen- 
art auf der Erde wandelnd und mit schönen Nymphen Abenteuer 
erlebend. Dass der Kult der letzteren in älterer Zeit zurückgetreten 
ist, wird schon durch das erst in späteren Perioden vorkommende 
Moment des Auftretens weiblicher Gottheiten bewiesen. Indräni z. B., 
eine der ältesten weiblichen Gottheiten, war ursprünglich die Mutter 
Indras. 1 — Waren die Figuren der Apsaras auch dem Brahmanismus 
verhasst, so konnte er des ihnen zu Grunde liegenden mythischen 
Elements doch nicht entraten. Die Wolken, die im Agni-Mysterium 
des IJgveda den Blitz zugleich zum Gemahl und zum Kind haben, 
mit denen dieser tändelt wie mit jungen Frauen, sind die ältesten 
Travestien der urindogermanischen Nymphenauffassung. Die striyäh 
des Agni werden von Säyana bisweilen treffend mit samgamanasva- 
bhäväb bezeichnet, d. h.: als Personen, in deren Natur die geschlecht- 
liche Vereinigung liegt, mit anderen Worten als Zeugungsmütter. 
Diese den Wortsinn unserer A9vamedha-Stelle interpretierende Auf- 
fassung der himmlischen und irdischen Wasser ist nun uralt und findet 
sich, wie bekannt, bereits im ältesten Veda vor. Die Sarasvati ist z. B. 
der ^mütterlichste' (ambitamä) 2 der Ströme. R. V. 10, 35, 2 werden 
mehrere Ströme als mätarah ,Mütter' bezeichnet, Vaj. Samh. 10, 7 
werden die Wasser ebenfalls ambitamäh genannt; cf. auch R. V. 1, 
23, 16 = A. V. 1, 4, 1. Ambä, Ambäyu und Ambikä sind Namen 
für Apsaras, cf. Pet Wörterb. Woher stammt aber die Dreizahl der 
angerufenen Nymphenwesen? Nach meiner Ueberzeugung handelt 
es sich dabei um die dreifach sich manifestierende Wasser- und 



* 



(T3 



Zeugungsgottheit, die in älterer Zeit dem Rudra, in jüngerer dem 
Qiva anvermählt wurde. Rudra ist der dreibeweibte Gott z. B. Tait. 



F P. 



Samh. 1, 8, 6, 2: ava . „ . rudram adimahi ava devam tryambakam; 
dazu die im Pet. Wörterb. citierten Stellen und Weber, Handschr. i, 

1061 Chamb. 314 tvyambaJcegvara — Qiva. Bisweilen wird eine 



der Semele (cf. Buchholz, Homerische Realien 3, 1, 301), von Zeus in seinem Schen- 
kel zur Reife gebracht. Er wird von Nymphen als Ammen auferzogen. 



(U ü 



1 Bloomfieldt weist ZDMG. 48, 579 auf Atharva-Veda 3, 10, 12 TS 4, 3, 
11, 3, Käth. S. 39, 10 hin. 

LH LT) * 

2 amhitame nadltame devitame sarasvati. 

-o v 

5* 

E => 

cn x: 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



68 Julius v. Negelein. 

einzelne Schwester oder Gemahlin Rudra's oder Qiva's als ambikä 
oder ambä bezeichnet. CB 2, 6, 2, 9 : ambikä ha vai näma asya 
svasa. Die Variante Maitr. Samh. 1, 10, 4 zu der eben mitgetheilten 
Taittiriya-Stelle lautet: ava amba rudramad imahi ava devam trya. 
mbakam, ein wohl verdorbener Vers. Von dem Gott saha svasrä 
ambikayä wird Tait Bräh. 1, 6, 10, 4 cf. Tait. S. 1, 8, 6, 1 geredet. 
Andre Stellen s. im Pet. Wörterb. Im Amara Kosa 1, 1, 1, 33 er- 
scheinen die Worte ambä und ambikä als Nomina propria von Qiva's 
Gemahlin Durgä oder Pärvatl. Harivafi$a 7589, sagt in einer An- 
rede an Rudra-Qiva: bhümitrayänäm deva yasmät pratisthä punar- 
lokärulm bhävano ameyaklrtih tryambaka iti prathamam tena näma 
tava. — Die natursymbolische Bedeutung der Trinität jener Gottheit 
ist demnach ersichtlich: es handelt sich um die im Himmel, Luft- 
raum und Erde fliessende Pärvatl. Als Strom wird dieselbe nicht 
nur durch die erwähnten Bezeichnungen, sondern durch ihre Ab- 
stammung vom Himavant charakterisiert. Ein Gebirgsfluss trägt nach 
Naigh. 1, 13 den Namen Pärvatl. Der Himavant geniesst göttliche 
Verehrung: Vaj. Samh. 24, 30; 25, 12, Ludwig, Rgveda m, 198. Viel- 
fach wird man Flüsse als Gemahlinnen von Bergen angesehen haben. 1 
Der Himavant heisst Menakaprane9a cf. Pet. Wörterb. Die Dreithei- 
lung des Flusses überrascht nicht. Mutete man doch auch der Gaügä, 
der Sarasvati u. s. w. mehrfachen Ursprung zu. Schliesslich sei noch 
auf einige Analogien von ethnologischem Interesse hingewiesen: wie 
die Wolkenwasser im Veda yuvatayah, so heissen sie in Baiern und 
Böhmen bisweilen ,Grossniütter'. 2 Die Silbe Me- heisst in einer An- 
zahl von Flussnamen Mutter, wie z. B. in Menam, worin die zweite 
Silbe , Wasser' bedeutet 3 Das Wort ,Mummel' bezeichnet zugleich 
eine Pflanze, die also ,Mühmchen' = Amme oder Mütterchen heissen 



Q. O) 



w I 

fN «/) 

, O) 

o y 



o E 



(T3 



2 5 



F P. 



u 

O <L> 

N 



1 ,Der besterhaltene Sonnenheld der Afrikaner ist Schango der . . . der Blitz- 
et Kultur 1, 321. 



und Donnergott der Yoruba. Er hat drei Frauen, Flüsse*. Frobenius, Ursp. 

=> o 
" ° 

2 "Wuttke, Aberglaube 24. Auch die Esten nennen das Wasser jMutter' 

ibM. 274. 

8 Zeitschr. f. EthnoL 17, 242. 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






Erklärung einer Veda-Stelle. 69 

würde, und einen Kobold oder eine Larve; 1 es ist also in der dem 
mütterlichen Element des Wassers entstammenden Blume selbst noch 
das lebende Nymphenwesen als innewohnend gefühlt worden. 

Wir glauben im Vorausgehenden bewiesen zu haben, dass die 
citierte Acjvamedha-Stelle die Anrufung einer dreifach sich manife- 
stierenden Zeugungsgottheit enthält, die einem aus dem droigetheilten 
Weltenraum sich dreifach ergiessenden Strome ihren Ursprung ver- 
dankt. Möglich, ja wahrscheinlich ist es, dass man unter den Namen 
der drei Göttinnen die Bezeichnungen der Schwestern oder Gemahlin- 
nen Qiva's oder Rudra's zu verstehen hat. Für das mythologische Ver- 
ständnis der Stelle ist diese Frage ganz unwesentlich. Die mit dem 
Hengste den (symbolischen) Coitus vollziehende Mahisi ruft eben, 
da sie gewahrt, dass das Thier zum Zeugungsgeschäft untauglich ist, 
klagend die der Geburt vorstehenden Göttinnen zur Hilfe. Man 
vergegenwärtige sich auch, dass der A^amedha an einem grossen 
Strom, nach der Aussage der erhaltenen alten Gäthä -Verse etwa an 
Gaögä oder Yamunä stattfindet, dass also die dem Strom entsteigen- 
den Wassergottheiten vielleicht in unmittelbarer Nähe anwesend ge- 
dacht werden. 

In der Uebersetzung der folgenden Worte bereitet noch das 
Verbum Schwierigkeiten. In der WEBER'schen Uebersetzung wäre 
der zu nayati gehörige Accusativ zu ergänzen; er hiesse aqvam und 
Wurzel nl hätte die Bedeutung ,mit Gewalt zu jemandem führen'; 
doch ist jenes wie dieses unmöglich, ganz abgesehen davon, dass 
wir in diesem Fall eine andere Verbalform, etwa nayatu statt nayati 
zu erwarten hätten. Denn die Ergänzung von agvam zu nayati ist 
sachlich undenkbar. Die Mahisi kann sich nicht vor einem Acte 
sträuben, dem sie die Erzeugung eines Sohnes verdanken will und 
der ihre rituelle Aufgabe beim Pferdeopfer ist. Der Widerwille einer 

° N 

der handelnden Personen würde zudem sicherlich die Wirksamkeit 

'i/l CT 
% T3 
> 

c 
ro 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

ro <V 

cn x: 
in 4-/ 

$£ 

£ ro f^* I 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Cl 



03 
CT 



O O 



ro 



des Opfers illusorisch gemacht haben. Ich vergleiche deshalb das 

CT 

na mä nayati kagcana mit dem unmittelbar folgenden na mä ya- 



1 Grimm, Myth. 4 , 2, 763. 



Original fronn 






70 Julius v. Negelein. Erklärung einer Veda-Stelle. 

bhati kagcana Tait. Samh. 7, 4, 19, 2. Wurzel nl muss die ab- 
geschwächte Bedeutung von yabh haben ; man könnte an unser 7 ver- 
führen' denken. Endlich beziehe ich subhadrikäm hämpilaväsinim 
auf mä und mache es von nayati als Object abhängig; subhadrikä 
mag seine traditionelle Bedeutung behalten ; es bezeichnet ein prächtig 
geschmücktes, also nach unseren Begriffen pikant aussehendes, zur 
Geschlechtslust reizendes und williges weibliches Wesen. Das passt 
sehr gut auf die nach ausdrücklicher Angabe der Texte kostbar ge- 
schmückte Mahisl, die eben den Coitus vollziehen will. Dass kämpila 
etwas mit einer Stadt zu thun haben sollte, ist schon deshalb höchst un- 
wahrscheinlich, weil die Brähmana-Texte, geschweige denn die ur- 
alte Taittiriyaschule, noch keine Städtenamen kennen und ausserdem 
dann wieder ein nur ganz local möglicher, improvisierter Vers vor- 
läge, der aus unbekannten Gründen typisch geworden wäre. Die 
Commentare geben zudem (zu Tait. Samh. 7, 4, 19) als Erklärung 
für kämpila das leicht verständliche ksamavastram und Weber Tait. 
Samh. ii. Band, S. 312, Anm. 6 identificiert es gut mit kambala; es 
handelt sich um die Decke, unter der Pferd und Königin schlafen. 

~ ö 

Ich übersetze also: 

z 7 

O Ambä, Ambälä, Ambikä, will denn niemand sich zu 
mir gesellen — das verfluchte Pferd schläft ja — die ich 
als prächtig geschmücktes Liebchen unter der Wolldecke 
hege? 

SS 

c ^ 

o E 

^-^ 4-1 

■o -b 
'£ 2 
§ i 

= i 

- "r? 

£ ö. 

P 

U 

«4- ~° 

O <L> 

*S 

'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 






Zur Interpretation des Veda. 

Von 

J. Kirste. 

Dass der Veda eine Sammlung von Hymnen der verschiedensten 
Provenienz, nicht bloss was die Persönlichkeiten der Verfasser, son- 
dern auch was Zeit und Ort betrifft, vorstellt, ist eine jetzt allgemein 
anerkannte Thatsache und es folgt daraus, dass die Exegese nicht 
für alle Stücke von demselben Gesichtspunkte, sei er nun natura- 
listisch, ritualistisch oder ethnographisch, ausgehen darf, sondern dass 
vor allem festgestellt werden muss, auf welchen Grundton, um mich 
so auszudrücken, ein Vers oder eine Anzahl von Versen gestimmt 
ist. Selbstverständlich schliesst dies nicht aus, dass man später den 
Worten einen anderen, als den ursprünglichen Sinn unterlegte, wie 
dies ja thatsächlich geschehen ist. Am schwierigsten ist es natürlich, 
das Grundprincip der Erklärung zu finden, wenn metaphorische 
Ausdrücke statt der gewöhnlichen, allgemein bekannten, gebraucht 
werden, zu deren Deutung uns häufig der Schlüssel fehlt und es 
wurde bezüglich solcher Stücke vor längerer Zeit von Henry 
die Vermuthung ausgesprochen, 1 dass sie schon ursprünglich als 

o t! 

Räthsel verfasst und als solche in die Sammlung aufgenommen worden 
seien. Nun will ich ganz davon absehen, dass das was uns räthsel- 
haft scheint, nicht noth wendig auch den Verfassern und ihren Zeit- 
genossen dunkel war, wobei die im Orient verbreitete abergläubische 
Scheu heilige Dinge bei ihrem wahren Namen zu nennen, nicht 



■o 

Q- 



.03 









> 

"c 

— o 

03 

5 S 



03 



03 



1 Revue critique, 1891, tome n, p. 498. 

.E "o 



'■o £ 

E-e 

E => 

03 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



72 J. KlRSTE. 

unterschätzt werden darf, aber, so frage ich, ist denn der Zweck 
des Räthsels nicht mit seiner Auflösung erschöpft? Welchen Sinn 
hätte es, ein Räthsel, wie: 

,Was taucht ins Wasser und kann nicht trinken?' 
in eine Sammlung von Gebeten aufzunehmen, wenn es ein Räthsel 
bleiben sollte? Denn, verstehen wir uns wohl, sobald ich dafür die 
Wendung gebrauche: 

,Sie taucht ins Wasser und kann nicht trinken', 
wobei sowohl Sprecher als Hörer an die Sonne denken, so haben 
wir es nicht mehr mit einem Räthsel zu thun, sondern mit einer 
metaphorischen Ausdrucksweise, die in einem Hymnus an die Sonne 
ganz wohl vorkommen kann. Wir dürfen also solche für uns ,räthsel- 
hafte' Wendungen, da sie sich in einer liturgischen Sammlung finden, 
meiner Ansicht nach, nicht als Räthsel bezeichnen, sollten sie auch 
ihren Ursprung einer Räthselfrage verdanken, denn durch ihre Ver- 
wendung zu einem andern Zwecke haben sie ihren Charakter als 
Räthsel eingebüsst. 

Einen neuen Beweis für seine Theorie findet nun Henry in der 
Strophe des Rigveda i, 152, 2, über die er in den Actes du douzieme 
congrls des orientalistes, tome i, Florence 1901, pp. 5 ff . gehandelt 
hat, und da ich schon in der Sitzung, in welcher der genannte Ge- 
lehrte seine Erklärung vortrug, meinem principiellen Zweifel an der 
Richtigkeit derselben Ausdruck gab 1 ohne jedoch die nöthigen Be- 
helfe für die mir richtiger scheinende zur Hand zu haben, so erlaube 
ich mir jetzt darauf zurückzukommen. 

Ich erwähne vor allem, dass Darmesteter, 2 den Ausdruck ca- 
tura§ri 7 der ,Vierspitz', bereits mit dem avestischen cathrugaosa, 
, viereckig', dem Beiworte Varena's, der dem vedischen Varuna ent- 
spricht, verglichen und ausserdem auf das ebenfalls im Rigveda v, 

ä -? 

1 Die Bemerkung im Protokolle der betreffenden Sitzung (Actes p. clx): 
,M. K. se declare satisfait* bezieht sich darauf, dass Herr Prof. Henry auf eine An- 
frage meinerseits die Güte hatte, sein Princip schärfer zu definieren. 

2 Ormazd et Ahriman, Paris, 1877. p. 70. 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



CÜ 






Cl 



I (ü 
O o 



F P. 



Zur Interpretation des Veda. 73 

48, 5 als Epithet Varu^a's sich findende caturanika, ,viergesichtig' 
verwiesen hat. Dass es sich hier in der That um Varupa handelt, 
ergibt sich doch unzweideutig daraus, dass der Hymnus an Mitra- 
Vavuna gerichtet ist, während Henry, gestützt auf das im Satapatha- 
Brähmana als Beiwort der Sonne sich findende catuhsrakti, , viereckig' 
und die in der späteren Ikonographie gebräuchlichen vier Arme 
Visnu's, den Ausdruck , Vierspitz' als Bezeichnung des Sonnengottes 
erklärt und vermuthet, dass man denselben durch die Figur eines 
Quadrates bezeichnet habe. Dem gegenüber darf wohl darauf ver- 
wiesen werden, dass die Sonne in Indien durch eine Scheibe oder 
ein Rad (cakra) dargestellt wird. 1 

Noch weniger begründet aber ist es, wenn Henry, um seine 
Vermuthung, dass in dem Verse von einem Kampfe zwischen Sonne 
und Mond die Rede sei, zu rechtfertigen, die Voraussetzung wagt, 
dass der letztere durch ein Dreieck figürlich dargestellt worden sei, 
was der Ausdruck triraSri, wie ich gerne zugestehen will, allerdings 
bedeuten könnte. Sehen wir uns aber in der vedischen Mythologie 
nach einem Wesen um, dem das Epithet der ,Dreispitz' zugetheilt 
werden kann, so kann dies nur Rudra-Siva sein, dessen Emblem der 
trisüla, , Dreispitz' ist. Ueber den Ursprung dieses Symbols ist 
schon viel geschrieben worden und es ist hier nicht der Ort darauf 
näher einzugehen, aber so viel dürfte wohl allgemein zugestanden 
werden, dass dieses Geräth in der Hand des alten Sturmgottes den 
Blitz, in der Hand des sich nur mühsam eine Stelle im Pantheon 
der Priester erringenden volkstümlichen Zeugungsgottes, der mit 
dem ersten später in eine Gestalt verschmolz, 2 die Geschlechtstheile 
darstellen sollte. 3 Einen direkten Beweis, dass die drei Zacken die 
männlichen Zeugungstheile darstellten, finden wir meines Erachtens 

in einer Bemerkung des Commentars zu Äsvaläyana's Gj-hya-Sütra 

t $ 



T3 



V öl 



T3 
Q. 



O o 



(T3 



= 1 

F P. 



<u 



TD 



1 Goblet d'Alviella, Bull, de VAcad. de Belgique. Bruxelles 1888, tome 16, 
p. 339. La migration des symboles. Paris 1891, p. 219. 

2 Muir, Original sanskHt texts. Vol. iv, p. 405 ff. 

3 Birdwood, JRAS. 1886, p. 408. Auch Simpson, JRAS, 1890, p. 313 kommt, 



allerdings auf einem Umwege, zu einem ähnlichen Ergebnisse. 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



74 J. KlRSTE. 

i, 13, 2, wo die bei Gelegenheit des Pumsavana, der Ceremonie um 
männliche Nachkommen zu erzeugen, der Frau eingegebenen zwei 
Bohnen und ein Gerstenkorn darauf gedeutet werden vgl. Hir. Gr. 
S. ii, 2, 2; 3. Ist dies richtig, so dürfen wir allerdings nicht mit 
Goblbt d'Alviella 1 in dem unter den Spitzen befindlichen Ringe ur- 
sprünglich das Bild der Sonnenscheibe suchen, was natürlich nicht 
ausschliesst, dass er später diese Bedeutung und dann die des 
Rades des Gesetzes bei den Buddhisten erhielt. Zu der hier vorge- 
tragenen Erklärung, nach welcher der schwierige Vers also besagen 
würde : ,Varuna schlägt Siva', würde die Bemerkung v. Schroeder's, 2 
dass die Dichter des Rigveda von einem Kult des Phallus nichts 
wissen wollten, vortrefflich stimmen. 

Noch ein paar Worte über die übrigen Verse der Strophe. 
Henry meint, 3 dass esäm nur auf den ersten Bestandtheil des im 
folgenden Verse stehenden Compositums kaviSasta bezogen werden 
könne und übersetzt daher: ,Voici un dicton des sages que n'entend 
pas le premier venu;' ich sehe aber keinen Grund, der uns ver- 
hinderte das Pronomen auf das im vierten Verse stehende devanido 
zu beziehen, worunter also nach dem vorhin Gesagten die sisnadeva 
zu verstehen wären, die Sivaverehrer. 4 Selbstverständlich bin ich auch 
mit der Behauptung ,On nous annonce donc qu'on va nous poser 
une önigme' 5 nicht einverstanden, sondern glaube, dass das Verbum 
vi ciketat in dem Sinne von ,er erfuhr' aufzufassen sei. Die ganze 
Strophe wäre darnach etwa folgen dermassen wiederzugeben: 
Dies hat wohl mancher von ihnen schon erfahren, 
Wahr ist der von den Weisen verkündigte schreckliche Spruch: 



T3 



ö. u 
.c o 



O -ö 
^ fi) 



w I 

fN CO 

, O) 

O u 



o o 

c v> 
o E 



(T3 



,Den Dreispitz tödtet der furchtbare Vierspitz' 



F P- 



u 

«4- ~° 

O <L> 



Auch die ersten 6 Götterfeinde gingen zugrunde. 



1 Bulletin etc. p. 341. 

2 WZKM. y ix, 237. 
» L c, p. 11. 
* Müib, l c, p. 407. 

5 l c. p. 9. 

6 d. h. die mächtigsten. 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






Zur Interpretation des Veda. 75 

Dass der mit Varuna eng verbündete Mitra in dieser Strophe 
beiseite gelassen wird, dürfte wohl keinen Einwand begründen, denn 
Varuna, der Allherrscher (samräj), der Hüter der göttlichen Ordnung 
(dhrtavrata), ist ja vor allen berufen, das heilige brahmanische Pan- 
theon gegen neue Eindringlinge zu vertheidigen. Mit der ihm hier 
zugetheilten Rolle würde die Ansicht, dass er, wie manche Gelehrte 
behaupten, ein alter Mondgott sei, freilich nicht stimmen und ich 
stehe daher entschieden auf Seite v. Schroeder's, 1 der diese Auf- 
fassung mit überzeugenden Gründen zurückweist und ihn für den 
Erben des alten Dyaus erklärt. Nur glaube ich, dass Varuija von 
der Wurzel üf, ,bedecken* im Sinne von ,der bedeckte Himmel', 
was sowohl den Wolkenhimmel, daher die Beziehung zum Wasser, 
als den Nachthimmel bedeuten kann, abzuleiten sei. Mitra, der 
klare Himmel, der Taghimmel und Varuna, der bedeckte Himmel, 
der Nachthimmel sind also im Grunde genommen nur zwei Seiten 
ein und desselben Naturwesens, das ursprünglich als Einheit dyaus 
der Erde prthivl gegenüberstand. 



1 WZKM. y ix, p. 116 ff. 



o -ö 
3 * 

^ (D 

m ^ 

° ^i 

fN CO 
f\l ^ 
, O) 

O U 

O o 

c ^ 
o E 

^-^ 4-1 

■o -b 
'£ 2 

= i 

- "r? 

£ ö. 

P 

U 

O <L> 

*s 

'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



Anzeigen. 



1. Grundriss der Indo - Arischen Philologie und Alterthumskunde, 
von Georg Bühler, fortgesetzt von F. Kielhorn. i. Bd., 10. Heft. 
Litteratur und Sprache der Singhalesen, von Wilhelm Geiger. 
Strassburg, Trübner 1901. 

2. Etymologie des Singhalesischen, von Wilhelm Geiger. Abhandl. 
der Je. bayer. Akad. der Wiss. i. Gl., xxi. Bd. 

t | 

Die beiden Hauptwerke auf dem Gebiete des Singhalesischen, 
welche uns der hochverdiente Forscher Wilhelm Geiger geschenkt 
hat, sollen hier zusammen besprochen werden, obgleich ein Zeit- 
raum von drei Jahren dieselben trennt. Das zuerst genannte Werk, 
welches einen Theil des BüHLER'schen Grundrisses bildet, beruht im 
wesentlichen auf dem an zweiter Stelle aufgezählten Verzeichniss 
singhalesischer Etymologieen, in dem der Verfasser zum ersten Male 
die Resultate seiner Forschungen auf diesem Sprachgebiet zusammen- 
gestellt hat. Natürlich umfasst das allgemeinere Werk einen weiteren 
Gesichtskreis. Geiger hat hier einen Ueberblick über die gesammte 
Struktur der singhalesischen Sprache gegeben ; während er sich bei 



T3 



03 






(T3 



= 1 

F P. 



<D 



der Etymologie im wesentlichen auf die Laut- und Wortbildungslehre 



=> o 



beschränken konnte, musste er hier auch die Nominal- und Verbal- 
en 

flexion in ihrem ganzen Umfang berücksichtigen und ferner die so 

<J3 

schwierige Frage nach der Abstammung des Singhalesischen ein- 
gehend besprechen und definitiv zu lösen versuchen. Ausserdem hat 

'■5 v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



GRUNDRISS DER InDO-ArISCHEN PHILOLOGIE ETC. 77 

er in der Einleitung (S. 1 — 25) eine vorzügliche Uebersicht über die 
Litteratur und die Inschriften von Ceylon gegeben. 

Zu dem Abschnitt über die Litteratur habe ich nur nachzu- 
tragen, dass das auf S. 4 erwähnte Prosawerk Dampiyä Atuvä 
Gätapada Sannaya im Jahre 1879 in Colombo veröffentlicht und der 
Traktat Heranasika vom Referenten im ,Festgruss an Roth' (Stuttgart 
1893) p. 25 — 30 abgedruckt und übersetzt worden ist. Was dann 
die Inschriften anbetrifft, so hat Geiger im wesentlichen die von 
P. Goldschmidt und vom Referenten aufgestellten Deutungen adoptirt. 
Nur in einigen wenigen Punkten weicht er ab, so in Bezug auf die 
grosse Inschrift beim Ambasthala Dägoba in Mihintale (No. 20 meiner 
Ancient Inscriptions of Ceylon). Ich hatte diese Inschrift dem König 
Meghavaijija I. zugeschrieben, weil es in Zeile 13 heisst, dass der 
König die Wohnungen des Mahinda und des Bhaddasäla wiederher- 
stellte gerade so wie der Mahävaipsa (p. 232) uns dies in Bezug auf 
Meghava^na berichtet. Geiger dagegen meint, dass sie von den- 
selben Königen herrührt wie die von Ratmala (No. 6), nämlich von 
Gajabähu und seinem Nachfolger Mallakanäga, weil nämlich auf 
beiden Inschriften die Teiche von Wihirabija und Mujagutika erwähnt 
werden, und es ist möglich, dass er Recht hat. Sehr dankenswerth 
ist der Abdruck des vollständigen Textes mit Uebersetzung der 

in 

Devanagala-Inschrift auf S. 21, 22. Auch über die Inschriften des 
Nissanka Malla und seiner Nachfolger berichtet Geiger ziemlich ein- 
gehend (S. 23, 24) und wundert sich mit Recht, dass über des ersteren 
Feldzüge nach dem indischen Festlande sowie über die verschiedenen 
Verträge und Bündnisse, die er mit indischen Fürsten abschloss, gar 
nichts im Mahävaipsa zu finden ist. 

Auf S. 26 beginnt die Grammatik und zwar wird zunächst die 
Lautlehre eingehend behandelt. Geiger hebt hervor (S. 28), dass haupt- 
sächlich drei Momente umgestaltend auf den singhalesischen Vocalis- 
mus eingewirkt haben: 1. die grundsätzliche Kürzung aller Längen, 
2. der Wortaccent, 3. das Gesetz von der Vocalassimilation. Die 
Kürzung der langen Vocale ist bereits auf den ältesten Inschriften 
fast vollständig durchgeführt mit einziger Ausnahme der Inschrift 



■o 






O o 



(T3 



= 1 

F P. 



u 

«4- ~° 

O <L> 

'in öi 

£ ? 

> <U 

=> O 



£ -ö 
-ö v 

E-e 

E => 

(ü <D 
m _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



78 E. Müller. 

vom Gallena-vihära (No. 2), welche Längen aufweist. Wenn sich im 

Neusinghalesischen ein langer Vocal zeigt, so ist er immer durch se- 

cundäre Contraction entstanden. Aber auch diese durch Contraction 

entstandenen langen Vocale sind wieder der Verkürzung unterworfen 

(S. 30), so z. B. in dem Verbum neranu ^beseitigen' = niharati, 

welches bereits in der Heranasika vorkommt (,Festgruss an Roth' 

p. 26). Dort werden nämlich die 10 dantjuwam eingetheilt in solche, 

welche durch Ausstreuen von Sand in den Hof des vihära's und 

solche, welche nur durch zeitweiliges Ausschliessen des Schuldigen 

aus der Priesterschaft gesühnt werden können, und die letzteren 

werden mit neranä wat bezeichnet. 

Auf S. 31 werden die Wirkungen des Wortaccents besprochen. 

Geiger sagt mit Recht, dass es nicht immer möglich ist, ältere und 

neuere Accentwirkung scharf zu scheiden. Unter den Beispielen, 

die er für die Verkürzung (richtiger den Abfall) der anlautenden 
-ö 

Silbe anführt, vermissen wir ein sehr bekanntes, nämlich rd = surd und 

durch einen Blick in die Etymologie des Singhalesischen (S. 73) er- 
fahren wir, dass Geiger dieses = rasa setzt. Ich kann ihm in diesem 
Punkte nicht beistimmen: In der Heranasika p. 25 wird unter den 
dasa sil als fünftes angeführt: rdha merin duruwima ^Enthaltung von 
geistigen Getränken'. Dies entspricht genau dem 51. Päcittiya surd- 
merayapdne päcittiyam (Suttavibhaüga n, 110) und gerade so wie 
wir singhalesisch vierin = meraya setzen, werden wir auch rdha 

o 

= surd setzen müssen. Rasa wird im Päli meines Wissens nie 

o ^ 

im Sinne von , geistige Getränke' gebraucht. Dagegen finde ich, 



T3 



.TD 



(T3 



dass die neue Etymologie von vaturu , Wasser' = vitthdra jedenfalls 
zu berücksichtigen ist, obgleich vitthdra im Päli immer in der Be- 



F P- 



deutung ,Breite, Ausdehnung' und nie im Sinne von ,Flut' ge- 
braucht wird. 

Im Capitel über die Vocalassimilation (S. 33 — 36) bespricht Gei- 
ger die Entstehung des neuen, dem Singhalesischen eigenthümlichen 






cn 



=> O 



nicht vorkommt, dagegen vom 10. Jahrhundert ab ungemein häufig ist. 



Vocals ae, der in den ältesten Inschriften bis zum 4. Jahrhundert noch 

Einige hieher gehörige Beispiele sind bereits auf S. 29 No. 2 vorweg- 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
<D zj 
O Q_ 



Original fronn 



GRUNDRISS DER InDO-ArISCHEN PHILOLOGIE ETC. 79 

genommen (wo ein Verweis auf § 9. 4 fehlt) wie rae ,Nacht' aus 
rätri, bae ,unmöglich' aus bddhita. Bestimmte Gesetze darüber, 
wann ae und wann e als Umlaut von a einzutreten hat, lassen sich 
nicht aufstellen. Wenn Geiger auf S. 29 3 das ae in Saegiri als eine 
Contraction von e -j- i hinstellt, so ist dies doch sehr zweifelhaft. Bae 
, Bruder' lässt sich allenfalls aus der Nebenform bhdtika erklären, die 
im Päli ziemlich häufig vorkommt. 

Unter der Ueberschrift Einzelerscheinungen^ werden in § 11 
und 12 diejenigen Veränderungen im Vocalismus zusammengefasst, 
die sich unter die vorher (S. 28) angegebenen drei Gesichtspunkte nicht 
subsumiren Hessen. Hieher gehören Fälle wie taek ,Molken' = takka, 
saev ,Bogen' = cdpa. Unter die Fälle, wo i und u ohne ersichtlichen 
Grund wechseln, rechnet Geiger auch musa ,Irrthum', welches er 
= pkt. misa setzt. Nach meiner Ansicht erklärt sich musa viel ein- 
facher = p. musa, skt. mfishd. Neben tota ,Furt' = skt. tirtha stellt 
sich präk. tüha Häla 192, Hern, i, 104. 

In § 13 geht Geiger zum Consonantismus über und behandelt 
hier zunächst die beiden dem Singhalesischen eigentümlichen Halb- 
nasale n und 7w, die er beiläufig schon auf S. 33 bei Gelegenheit 
der Vocalelision erwähnt hatte. Bereits in den ältesten Inschriften 
herrscht die Tendenz, bei der Verbindung Nasal + Consonant den 
Nasal zu zerstören, oder, wie Geiger sich ausdrückt, ihn in den 
Halbnasal zu verwandeln, der aber in den Inschriften nicht bezeichnet 
wird. Diese Neigung der Sprache scheint mehrere Jahrhunderte vor- 
geherrscht zu haben (vgl. auch § 17), erst in späterer Zeit finden 
wir das entgegengesetzte Princip in Thätigkeit, nämlich einen ein- 
fachen Explosiv durch Vorschiebung des betreffenden Nasals und 
einen einfachen Nasal durch Hinzufügung des betreffenden Explosivs 
zu verstärken. Geiger hat die Vorschiebung des Nasals in § 20. 2 
behandelt, die Hinzufügung des Explosivs in § 25. 5. Es hätte aber 
hervorgehoben werden sollen, dass diese Erscheinungen der späteren 
Zeit angehören. Formen wie pandura ,Geschenk, Tribut' = pannd- 
kdra, hambu ,Haferschleim' = dcdma, mundu = mürdhd finden sich 
erst auf der Ambasthala- Inschrift (No. 121). Für kanda ^erhöhtes 



T3 



ö. 2> 



Cl 



<=> o 

c v> 
o E 

^-^ 4-1 

TD ±3 

P 

ro ^ 
U 

«4- "ö 

O <L> 

N 
'-I-J 

"o 
> 

c 

CO 

ifl tn 

£ -o 
-o v 

E-e 

E => 

ro O) 
to r 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



80 E. Müller. 

Ufer' = skhanna haben wir sowohl Hab. 2 wie auch Amb. B 55 noch 
die ältere Form kana. 

Unter den Beispielen für den Wechsel zwischen n und l führt 
Geiger auch pihinanu an, welches er auf p. piluvati zurückführt. 
Diese Etymologie scheint mir unmöglich, vielmehr ist pihinanu von 
Ysnd abzuleiten. Schwierigkeiten macht eigentlich nur das Präfix 
pi und wenn man dies nicht = api setzen will wie in p. pithiyati, 
pilandhati, was nach meiner Ansicht ganz gut ginge, so könnte 
man immer noch einen zusammengesetzten Verbalstamm annehmen, 
wie Geiger deren eine Anzahl in § 67 aufführt. 

Auch mit der Erklärung von nimenu ,erlöschen, aufhören' aus 
p. nibbdti in § 25. 4 bin ich nicht einverstanden. Das Absol. nimaway 
oder nimawä findet sich mehrmals inschriftlich, so Amb. A 10, P. P. 
3, 32, 33, ebenso der Infinitiv nimaeviyae Amb. A 58. Es hat hier 
immer die Bedeutung , vollenden', passt also viel besser zu p. nimmd- 
yati, skt. nirmd. Auch Cloügh giebt dem Aktiv nimawanawd die 
Bedeutung ,to finish, to end, to complete' und dem Passiv nimenawd 
,to be finished, to be completed'. 

Auf S. 46, Anm. 3 führt Geiger die Form seyin , wegen' an, 
die er als eine falsche Bildung für heyin = hetund auffasst unter 
Herbeiziehung von se, he = setu ,Brücke'. Die Form seyin lässt 
sich nach meiner Ansicht viel einfacher erklären, wenn wir skt. 
chdyd zu Grunde legen, dagegen bleibt das 8 in siriyal = haritdla 

O o 

und in kesel = kadali räthselhaft. 

Im zweiten Capitel beginnt die Formenlehre und zwar zunächst 

'(75 ^ 

die Flexion des Substantivums. Geiger's Bemerkungen über die 
verschiedenen Nominalstämme mit und ohne Reduktionsvocal sowie 
über die mit Suffix ka abgeleiteten Masculin- und Femininstämme 
scheinen mir durchweg zutreffend. Eine neue Etymologie für das 
Pluralsuffix wal giebt er nicht, sondern begnügt sich damit, dasselbe 



T3 



ö. 2> 



ro 
F p. 



u 

«4- ~° 

O <L> 



■h! ■— 

als sicherlich arisch oder doch arisirt' zu bezeichnen im Gegensatz 
zu Gunasekara, der an eine Entlehnung aus dem Tamil glaubt 

ro 

(§ 38 n). Inschriftlich findet sich die Endung val zuerst im 15. 
Jahrhundert, nämlich in einer Inschrift des Königs Paräkramabähu VI. 

'-o v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



GRUNDRISS DER InDO-ArISCHEN PHILOLOGIE ETC. 81 

von Kotta (No. 160 der Ancient Inscriptions of Ceylon vgl. Geiger 
§ 15. l) 2 Abi. PI. gamwalin und viharawalin, dagegen findet sich 
ein jedenfalls verwandtes Suffix -war in den Inschriften des 11. Jahr- 
hunderts. Allerdings kommt dieses Suffix dort nur sporadisch vor, 
während gewöhnlich die Plurale ohne Suffix gebildet werden (Geiger 
§ 34. in. 2). Es scheint mir nun durchaus nicht unmöglich, dass nach 
der grossen Tamil-Invasion im 12. Jahrhundert, wo überhaupt viel 
dravidische Elemente in die Sprache aufgenommen wurden, wie wir 
später noch zu sehen Gelegenheit haben werden, dieses Suffix war 
durch den Einfluss der Tamil-Endung kal in wal verwandelt worden ist. 

Das Dativsuffix ta leitet Geiger (§ 40, 5) von dem Acc. attham 
ab, während man es früher auf den Dativ atthäya zurückführte. Die 
inschriftlichen Formen cetahata, bikusagahata lassen beide Ableitungen 
zu, während bikusagahataya (No. 11), bukasagahataya (No. 10) und 
hamananataya (No. 61, Zeile 8) doch deutlich auf den Dativ hinweisen. 
Die Form bikasagata in der sechsten Zeile der Kaikäwa-Inschrift 
(No. 13) halte ich auch für einen Irrthum des Steinmetzen statt bika- 
sagahata (S. 62, Anm. 4). 

Beim unbestimmten Substantivum (§ 42) hat Geiger nicht be- 
merkt, dass diese Formen, die mit dem Zahlwort eka zusammen- 
gesetzt sind, sich schon in den Inschriften des 11. Jahrhunderts 
finden. 

§ 47 — 51 handelt von den Pronominibus. Geiger fuhrt mama 
als Nom. Sing, des Pron. der 1. Person an und verweist in der Note 
auf Childers' Bemerkungen JRAS. vm, 136, erklärt sich also damit 



■o 






O -ö 



w i 

fN CO 

O u 



O o 
c ^ 

o 2 



(T3 



einverstanden. Nach meiner Ansicht ist dies einer der wenigen 
Fälle, in denen Childers den Geist der singhalesischen Sprache 



F P. 



total missverstanden hat. Er wählt als Beispiel den Satz mama giya 
ge ,das Haus zu welchem ich ging' und übersetzt diesen Satz in's 



u 

«4- ~° 

O <L> 

Päli zurück als mama gatageham, eine Construction, die jedenfalls 

> <u 

C CT 
=> O 



auch nicht gerade als klassisches Päli gelten kann. Immerhin ist 
das Beispiel in so fern geschickt gewählt, als hier wirklich in mama 
eine Form vorliegt, die man beliebig als Nominativ und als Genitiv 
fassen kann. Wenn wir aber etwa den Satz nehmen in der vierten 

Wiener Zoitschr. f. <1. Kunde d. Moroni. XVI. Bd. G 

E =3 

ft3 <D 

to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



82 E. Müller. 

Reihe der Ambasthala-Inschrift (No. 121): Seygiri weherhi isä Abahay 
giriweJierJii isä wasana maha biksang ,die Brüderschaft der Mönche, 
welche in Seygiri und in Abhayagiri wohnen' so kann man die 
Worte maJia bik sang nicht beliebig als Nominativ und Genitiv, 
sondern nur als Nominativ fassen und damit fällt die ganze Chil- 
DERs'sche Erklärung zusammen mit seiner Uebertragung in's Päli. 
Auch Alwis ist in seinem dieser Erscheinung gewidmeten Abschnitte 
nicht glücklicher (,On the Origin of the Singhalese language' im 
Journal of the RAS. Ceylon branch vol. 1867 — 70 p. 54 — 55 und 
76 — 78). Es war ihm aufgefallen, dass das Singhalesische gerade wie 
die dravidischen Sprachen kein Relativpronomen besitzt (s. Geiger 
§ 50), sondern es durch das relative Participium ersetzt. Um jedoch 
keinen Einfluss des Dravidischen auf das Singhalesische zugeben zu 
müssen schlägt er einen ähnlichen Weg ein wie Childers. Sein 
Beispiel ist mama Jcarana de ,Das Ding, welches ich thue' (Tamil 
ndn Sekir velei), aber, während Childers mama als Genitiv auffasst, 
sieht Alwis darin einen Instrumental und überträgt die ganze Con- 
struetion in's Passiv. Nach ihm sollte es eigentlich heissen: mä 
Jcarana de ,das Ding, welches von mir gethan wird'. Die Unhalt- 
barkeit dieser Ansicht leuchtet sofort ein, denn, wenn wir auch zu- 
geben wollten, dass die Form mama für den Instrumental gebraucht 
werden kann, so könnte doch nimmermehr das relative Participium 
Jcarana als Passiv gelten. Ein anderes, noch eklatanteres Beispiel 
finden wir im Appendix zur Sidat Sangaräwa p. 164. Dort ist der 
Satz aus i Cor. 15, 1 : ,Ich erinnere Euch aber, meine Brüder, des 
Evangelii, das ich Euch verkündet habe, welches Ihr auch an- 
genommen habt, in welchem Ihr auch stehet', folgendermassen über- 
setzt: Tavada saJiodarayeni mama topata prakdsakaldwu topi pili- 
gattäwu topi pihita sitinnäwü suba äranci topata danwami. Hier 
haben wir drei relative Participia praJcdsakaläwu y piligattdwu und 
sitinnäwü; das vor dem ersten stehende mama könnte man ja allen- 
falls mit Childers als Genitiv betrachten, für das vor den zwei 
letzten stehende topi aber ist eine soche Auffassung unmöglich, da 






* 



.TD 

ü> 

s— 
O 



(T3 



2 5 



> <u 
S 5« 






7n 

topi immer nur als Nominativ gebraucht wird. Ich glaube also, dass 

E-e 

E => 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original fronn 






Grundriss der Indo-Arischen Philologie etc. 83 

diese Constructionen ganz der dravidischen Analogie folgen: mama 
karana de entspricht genau dem Tamil ndn Sekir velei, wo nein und 
velei Nominative sind und das dazwischenstehende Sekir ein relatives 
Participium. Da wir zwischen dem 5. und 9. Jahrhundert nur sehr 
wenige Inschriften in Ceylon besitzen (s. Geiger § 12), so ist es un- 
möglich genau zu sagen, um welche Zeit diese dravidischen Con- 
structionen in die Sprache eingedrungen sind. Im 8. Jahrhundert 
wurde die Hauptstadt des singhalesischen Königreichs in Folge der 
fortwährenden Einfälle der Tamilhorden aus Südindien von Anurädha- 
pura nach Pulastipura, dem späteren Polonnaruwa verlegt und es ist 
wahrscheinlich, dass die Tamilherrschaft sich dort bis in die Zeit 
des Paräkramabähu L, also bis in's 12. Jahrhundert aufrecht erhielt. 
Es ist dies die Zeit des tiefsten Verfalls des singhalesischen König- 
thums und der von demselben abhängigen buddhistischen Priester- 
schaft. Auch der Tempel von Mihintale scheint eine Zeit lang in 
den Händen der Tamil gewesen zu sein, bis er (wahrscheinlich von 
König Mahinda III.) zurückerobert wurde, denn am Ende der von 
mir schon öfter erwähnten Ambasthala-Inschrift heisst es: kanae 
icaewae diyaican tdk tanhi pere Demel kalae pere sirit diya beduvi 
me weherat me gatae yutu ,So viel Wasser wie in dem Canal und 
in dem Teich ist, soll unter die zu dem Vihära gehörigen Ländereien 
vertheilt werden in der Art und Weise wie es früher von den Tamil 
festgesetzt worden ist'. Da somit das ganze Land Jahrhunderte lang 
von den Tamil überschwemmt war, so ist es keineswegs zu ver- 
wundern, dass dravidische Elemente in das Singhalesische ein- 



Q. 



.TD 



(T3 



gedrungen sind und sich dort auch später noch erhalten haben, 
nachdem das Land durch Paräkramabähu I. wieder von den Feinden 



F P. 



gesäubert war. 

Von § 52 an wird die Verbalflexion behandelt und zwar zu- 
nächst das Elu-Verbum, welches sich von dem der Umgangssprache 



T3 



ziemlich scharf unterscheidet. Geiger theilt das singhalesische Verbuin 

CT) 

nach dem Ausgang des Präsens-Stammes und nach der Bildung des 



c 
ru 

ru 



Präteritums in drei Conjugationen ein, von denen die erste Transitiv«, 



fD 



die zweite Transitiva und Intransitiva, die dritte Intransitiva und 



£ -o 



6* 



o c 
E => 

fü <D 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



84 E. Müller. 

Passiva umfasst. In § 54 werden dann die sogenannten unregel- 
mässigcn Verba behandelt, welche eine eigentümliche Präterital- 
bildung aufweisen. Unter den Infinitiven in § 57 vermisse ich die 
zahlreichen Formen auf ae wie haendae, perewae, diyae, waesae, 
welche wir in der Ambasthala-Inschrift und in andern Denkmälern 
des 11. Jahrhunderts finden. Diese Formen sind meistens abhängig 
von dem Particip yutu = yuktam ,es ziemt sich, es ist vorgeschrieben'. 
Aehnliche Formen, allerdings auf a ausgehend, finden sich in der 
Heranasika (,Fesigruss an Roth' p. 28) z. B. gaela, gata, sewiya, kiwa 7 
putca. Was die Bildung anbetrifft, so finden wir weder im Sanskrit 
noch im Päli Analogien dafür, man müsste denn Infinitive des Päli 
wie dakkhitdye, jagghitdye hieher rechnen wollen, die aber viel zu 
selten sind um als Vorbild für diese überaus häufigen singhalesischen 
Formen gelten zu können. Dagegen sind die Infinitive im Tamil 
ganz ähnlich gebildet, wie z. B. vara sollu ,sage ihm zu kommen' 
d. h. ,er soll kommen'. 

Geiger hätte überhaupt im Abschnitt vom Verbum noch einmal 
ausdrücklich hervorheben können, was ein aufmerksamer Leser sich 
allerdings aus seiner Uebersetzung und seinen Anmerkungen zu der 
Devanagala-Inschrift (§ 13) selbst deduciren kann, nämlich, dass in 
den Inschriften vom 10. Jahrhundert an das Verbum finitum fast 
vollständig erloschen ist und alle Beziehungen durch Infinitiv- oder 
Participialconstructionen ausgedrückt werden. In den Inschriften 
finden sich noch vereinzelte Formen des Verbum finitum, so in Parä- 
krainabähu's Inschrift beim Galwihara (No. 137) eine 1. sing. leerem, 
auf dem Fries beim Thüpäräma (No. 147) eine 1. sing. demi y in 
Nigyanka Malla's Inschrift am Dalada Man<Jiräwa (No. 149) eine 
3. PI. nasiti ,sie verderben' (Z. 36), in der vorhergehenden Zeile aber 
die Formen kaldhu und kaewo, die nach einem ganz andern Princip 
gebildet sind. Es scheint also, dass in dieser Zeit (zwischen dem 
10. und 12. Jahrhundert) die alte präkritische Flexion allmälig ab- 
gestorben und durch eine neuere ersetzt worden ist, deren Principien 
uns Geiger in den herangezogenen Paragraphen über das Eluverbum 
auseinandersetzt. In der Zwischenzeit dominiren die Participial- und 



t! öi 



ü -ö 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



2 5 



F P. 



u 



'öl 

<U , 

> <u 

C CT 

=) o 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 

ü Q_ 



Original fronn 



GRUNDRISS DER InDO-AiUSCHEN PHILOLOGIE ETC. 85 

Gerundialconstructionen (in der Inschrift von Ambasthala sogar aus- 
schliesslich). Geiger zählt in § 55 eine Anzahl dieser Participia 
auf, die zum Theil noch auf alte Päliformen zurückgehen. In § 56 
bespricht er das Gerundium auf min(i) und erklärt dieses als Instru- 
mental eines Verbalnomens auf -m, während Childers (Notes 
ort the Singh. Lang, n, 20), Alwis und Gunasekara darin das alte 
Partie, ätmanep. auf mdna erkennen wollen. Ich neige mich mehr 
der letzteren Ansicht zu, denn es ist absolut kein Grund einzusehen, 
warum diese Form immer im Instrumental gebraucht werden sollte. 
Ganz andere Bildungen sind die Verbalnomina auf ma wie naetuma 
oder naetima, ,das Tanzen', daenima ,das Wissen'. Die ältesten 
Formen dieser Art sind senim, saengim und siwim in der Inschrift von 
Mahäkalattaewa (No. HO), ferner kirimen in der absichtlich antiki- 
sirenden Inschrift am Galwihära (No. 137, Zeile 13, 31, 37). Eine 
ganze Anzahl finden sich in der Heranasika, nämlich aedurima, hin- 
dima, piligaenima, pirihelima, hinima, bindawima, hoivima. Gotj> 
schmidt (JRAS. Ceylon branch 1879 p. 24) wollte sie als Zusammen- 
setzungen aait karma ansehen und brachte palisatariltama der Haba- 
rane-Inschrift (No. 61) damit in Verbindung. Mir scheint die An- 
nahme einer so starken Synkope immerhin bedenklich und ich möchte 
an Bildungen erinnern wie Päli adhovima ,was nicht gewaschen zu 
werden braucht' Mahävamsa p. 70, Dipavamsa p. 62. 

Zu § 66 Bildung des Passivs möchte ich bemerken, dass ausser 
den von Geiger aufgezählten Umschreibungen mit labann, yedenu 
auch eine mit Jcanawd , essen' existirt ganz analog der im Tamil ge- 






O -ö 
^ fl) 



w I 

fN CO 

r\l ^ 

, 0> 

O u 



o o 

c v> 
o 2 



CO 



bräuchlichen mit un z. B. adi andän ,er wurde geschlagen' wörtlich 
,er ass ein Schlagen' (vgl. Caldwell, Comparative Grammar of the 



F P. 



Dravidian languages, p. 358). Von sonstigen Analogieen in der Con- 
struetion von Singhalesisch und Tamil möchte ich noch erwähnen die 

o Qj 

verneinende Form mit nae und dem Infinitiv z. B. mama enne nae 
,ich gehe nicht'. (Im Englischen lässt sich der Unterschied nicht 



einstimmt.) Ganz ähnlich ist das Tamil vara-v-illei. Diese Aus- 



Cü 

_N 
'-I-J 

'oi 
£ =5 
> <u 

C öl 

markiren, weil der Infinitiv mit der Form des Verbum finitum über- 

CO 

drucksweise gilt zwar im Tamil nicht als klassisch, sondern gehört 

E-e 

E => 

CO 0) 

to _C 
in 4-/ 

s_ C 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

CD 3 

ü Q_ 



Original fronn 



86 E. Müller. 

der Sprache des täglichen Lebens an, ist aber für die Vergleichung 
nur um so werthvoller (vgl. Caldwell p. 367). Ein anderes eigen- 
tümliches Idiom des Singhalesischen ist das Verbot, welches mit 
epd schliesst (Geiger § 57 und § G2, Anm. 4). Ueber die Etymologie 
des Wortes epd habe ich nichts sicheres ausmachen können; in- 
schriftlich kommt es, wie leicht zu begreifen ist, nicht vor, und wir 
haben daher keine Anhaltspunkte, um das Alter des Wortes zu be- 
stimmen. Es wird construirt mit dem Infinitiv, der durch die Dativ- 
endung ta charakterisirt ist, also z. B. kathdkaranda epd ,rede nicht, 
sei still'. 

In § 67 kommen die zusammengesetzten Verba zur Sprache. 
Etwas ähnliches findet sich auch in den nordindischen Sprachen und 
Beames (Compar. Grammar of the modern Aryan vernacular of 
India in, 215), Caldwell, Compar, Grammar of the Dravidian lan~ 
tjuages p. 342 haben für das zweite Verbum in einer solchen Combi- 
nation den Terminus ,ancillary' eingeführt zum Unterschied von 
einem gewöhnlichen Hülfsverbum, das als ,auxiliary' bezeichnet wird. 
Geiger hat sich im Grundrias auf wenige Beispiele dieser zusammen- 
gesetzten Verben beschränkt, die mir keinen Anlass zu weiteren 
Bemerkungen geben, in der Etymologie werden noch eine Anzahl 
anderer erwähnt, aber ohne Anspruch auf Vollständigkeit. Ich will 
hier noch Einiges aus meinen eigenen Beobachtungen hinzufügen: 
1. pinanawd (oder pihinanawa) 1 ^schwimmen' ist zusammengesetzt 
aus pi = präkr. pus, skt. pronch und snä. Malediv. finang Chri- 
stopher 71. Diese Ableitung passt besser zur Bedeutung des Wortes 
als die von Goldschmidt vorgeschlagene von pd ,trinken'. 2. kimi- 
dinaicd ,tauchen' enthält wahrscheinlich als ersten Bestandtheil die 
Wurzel kar ,machen', obgleich die Bedeutungsentwicklung nicht ganz 
klar ist. Der zweite Bestandtheil ist ^rnajj } der wir in der Form 
mujita , überschwemmt*' bereits in der Habarane-Inschrift (No. 61) 
begegnen. Ein Particip kumuta findet sich Sidath Saftgaräwa 57. 



ö. 2> 

■= 8 
3 * 

^ (D 

m </» 

° ^i 

fN CO 
f\l ^ 
, O) 

O o 

c v> 
o E 

^-^ 4-1 

TD ±3 

> ^ 

£ ö. 

P 

ro ^ 
U 

O <L> 
N 
'-I-J 
'Ol 

fc =9 

> <u 

C CT 
=) O 

— o 

c O 

bedeutet ,sich freuen 4 . Das Absolutiv pinawd findet sich in der Galpota-Jnschrift 
(No. 148) B 9. 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



1 pinanawd mit £ ist nicht zusammengesetzt, sondern von pA abgeleitet und 



Original fronn 



GRUNDRISS DER InDO- ARISCHEN PHILOLOGIE ETC. 87 

Auch in der Päli Dhätumanjüsä wird eine Wurzel mujj ,tauchen< 
aufgeführt, die aber sonst nicht belegt ist. 3. sanasanawd ? trösten' 
hängt jedenfalls mit skt. snih (wovon sneha ? Liebe') zusammen. Das 
Absolutiv sanahd findet sich inschriftlich Galpota (No. 148) B 5 und 
scheint ein corrumpirtes Tatsama zu sein. Zur Vergleichung bietet 
sich Päli senesika ,ölig ; fettig' Mahävagga vi. 1. 4, das jedenfalls 
auch von Wurzel snih kommt und dieselben lautlichen Veränderungen 
zeigt wie das singhalesische Verbum. 4. sindhenatod ,Iachen' ist ab- 
geleitet von dem Substantiv sind , Gelächter' in der Galvihära-Inschrift 
Zeile 41 ; Heranasika, Nämaw. 69, Maledivisch heng Christopher 59. 
Dieses sind ist eine Weiterbildung von Päli sitam, skt. smitam. 
5. tcamdranawd ^erbrechen' und ivapuranawd ,säen' gehen jedenfalls 
auf die Wurzeln vam und vap zurück, doch ist das r in der Ab- 
leitungssilbe sehr schwer zu erklären. Bei ivapuranawd könnte man 
etwa an das Substantiv vapra ,Erdwall' denken. Vielleicht sind 
aber die Verba auch mit -\/kar zusammengesetzt. Auch bei 6. icadd- 
ranawd ,sagen, befehlen' befriedigt mich die Erklärung von Gold- 
schmidt (= Päli avadhdreti), der sich Geiger in der Etymologie 
anschliesst, nicht. Auf die vereinzelte Form vajeriyi in der Inschrift 
von Badagiriya (No. 68) will ich kein Gewicht legen, weil diese In- 
schrift zu schlecht erhalten ist, als dass man irgend eine Vermuthung 
über ihren Inhalt äussern könnte, dagegen finden sich die Formen 
wajdrat, waejaeriyae in der Ambasthala-Inschrift A 16, 17 und das Sub- 
stantiv icaejaerma ib. B 20. Die Bedeutung ist beaufsichtigen, con- 
troliren, tadeln'. Vielleicht ist an Päli vicdreti zu denken, doch gebe 
ich das nur als eine Vermuthung. Rajjam vicdreti heisst ,das König- 
reich verwalten, die Regierung fuhren' Mahäwamsa 216, 254. Der 
Uebergang von c zu d durch die Vermittlung von j ist nicht un- 
gewöhnlich im Singhalesischen, z. B. da = ca, aeduru = dcdriya, 
goduru = gocara (Grundriss § 23. 3). 7. ambanawd ^treiben' stelle 



o -ö 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



(T3 



2 5 



F P. 



u 

«4- "O 



CT 



ich nicht zu der nur im Dhätupätha belegten Wurzel amb, sondern 



> <u 



zu Päli abbeti, welches nach Trenckner Pdli Mise. p. 64 für dva- 



yati steht. 1 



l s 

1 Im Jätaka No. 311 (Fattsbüll iit, 35) ist statt appwiti: ahhenti zu lesen. 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



88 E. Müller. 

Im dritten Capitel giebt Geiger noch einmal zusammenfassend 
seine Ansicht über den sprachgeschichtlichen Charakter des Singha- 
lesischen und zwar erklärt er dasselbe im Anschluss an Childers, 
Rhys Davids, P. Goldschmidt, und des Referenten und im Gegensatz 
zu Friedrich Müller für einen rein arischen Dialekt. Ich stehe in 
dieser Beziehung auch noch auf demselben Standpunkt, den ich vor 
20 Jahren eingenommen habe, begreife aber nicht recht, warum 
Geiger gerade das Englische als Analogie herbeizieht (§ 72), um 
daran die Stellung des Singhalesischen im Kreise der arischen Spra- 
chen zu illustriren. Das Englische ist ein germanischer Dialekt, 
welcher zahlreiche französische Lehnwörter in sich aufgenommen 
hat, dessen Struktur aber durchaus germanisch geblieben ist. Das 
Singhalesische dagegen hat verhältnissmässig wenige dravidische 
Lehnwörter aufgenommen (Geiger p. 88), dagegen lässt sich nicht 
verkennen, dass der Satzbau desselben vom 10. Jahrhundert an in 
einigen Punkten durch das Dravidische beeinflusst worden ist. Ich 
habe vorhin (S. 7) schon bei Besprechung des relativen Participiums 
auf die analoge Construction im Tamil hingewiesen, ebenso bei den 
Infinitiven auf ae, bei der Bildung des Passivs, bei der verneinenden 
Form und dem negativen Imperativ (S. 10). Was den Conditional 
anbetrifft, so erkennt Geiger (S. 86) selbst an, dass dies eine ,selt- 
same^ Form sei und er weiss nicht recht, ob es ihm gelungen ist, 
für sie eine Erklärung aus dem arischen Sprachmaterial nachzu- 
weisen. Ich glaube, dass wir viel besser thun, das Singhalesische 
nicht mit dem Englischen, sondern mit dem Französischen zu ver- 
gleichen, denn hier liegen die Verhältnisse ganz ähnlich. Das Fran- 
zösische ist ein romanischer Dialekt, welcher nur wenige keltische 
Lehnwörter in sich aufgenommen hat, dagegen in seinem Satzbau 
durch das Keltische beeinflusst worden ist. Ich rechne hieher haupt- 
sächlich die Wendungen mit cest am Anfang des Satzes, in welchem 
der übrige Inhalt der Aussage in Form eines Relativsatzes nachfolgt 
z. B. (Irisch) Is tre banscäl tainic bas da m-bith = c'est par les 
femmes que la mort est venue dans le monde (vgl. Windisch in 
Grökner's Grundriss der romanischen Philologie i, 310 f.). Natürlich 



ti öi 



O -ö 
^ fl) 



O) 

^ u 

O o 

c v> 
o E 



ru 



2 5 



F P. 



u 

«4- ~° 



'öl 

<u , 
> <u 

C CT 

=> o 

— o 

CO 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



GRUNDRISS ETC. PrELIMINARY REPORT, ETC. 89 

geht Friedrich Müller zu weit, wenn er wegen dieser vereinzelten 
Dravidismen im Satzbau das Singhalesische für eine dravidische 
Sprache erklärt und die unverkennbar arischen Bestandteile als 
Lehnwörter bezeichnet. 

Zum Schluss (§ 73) wirft Geiger noch einen Blick auf die dem 
Singhalesischen am nächsten verwandten Dialekte der Mäldiven, der 
Vaedda und der Rocjiya, stellt dann (§ 74) fest, dass die ersten 
arischen Colonisatoren Ceylons aus dem Nordwesten von Indien 
stammten, und bespricht endlich (§ 75) das Verhältniss des Singha- 
lesischen zum Päli, zum Mahäräshtri und zu den modernen indischen 
Dialekten; er kommt hierbei zu dem Resultat, dass Sindhi, Gujarati 
und besonders Maräthi am allernächsten mit ihm verwandt sind. 

Wir sind nun am Schluss dieser ziemlich langen Besprechung 
angelangt, die nicht deshalb so lang geworden ist, weil wir viel an 
dem zu besprechenden Buche auszusetzen gefunden haben, sondern 
weil wir in dem uns vom Verfasser gebotenen Material so viel An- 
regung erhalten haben, auf dem von ihm eingeschlagenen Wege 
weiter zu forschen und unserseits auch etwas zur Erhellung . der 
vielen noch dunkeln Punkte beizutragen. Wir scheiden von dem 
Werke, indem wir unsere lebhafte Freude aussprechen über die 
Bereicherung, die der Grundriss der Indo-arischen Philologie und 
Alterthumskunde dadurch erhalten hat. 

Bern, October 1901. E. Müller. 



0) 

■o 



Q. 
^ fl) 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



u 

O <L> 

CT 



M. A. Stein, Preliminary Report on a Journey of Archaeological and 
Topographical Exploration in Chinese Turkestan. Published under 
the Authority of H. M.'s Secretary of State for India in Council. 
London 1901. 



den Stein in dieser vornehm ausgestatteten Publication von seiner so 



Mit Dank und Freude begrüssen wir den vorläufigen Bericht, 

=> o 

— o 
CO 

überaus erfolgreichen archäologischen Entdeckungsreise nach Khotan 

"* 'S 

giebt. Die Erwartungen, welche man nach seinen in dieser 7j\\t- 

o** 

E => 

fD O) 

to _c 
in +j 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



t! öi 



90 M. A. Stein. Preliminary Report, etc. 

schrift Heft 2. 3 veröffentlichten kurzen brieflichen Berichten hegen 
musste, haben sich in reichstem Masse erfüllt. Zum ersten Mal hat 
ein competenter Alterthumsforscher dies wichtige, unser Interesse 
schon lange fesselnde Gebiet gründlich durchforscht und reiche Aus- 
beute mitgebracht. Die verlassenen Wohnstätten nördlich von Niya 
und in der Gegend des Endere-Flusses haben die Arbeit des Ent- 
deckers am schönsten belohnt, aber auch Dandän-Uiliq, Yotkan, 
Rawak und andere Punkte haben ihren Antheil beigesteuert. Wir 
erwähnen etwa 500 Kharoshthi-Documente, auf Holzplatten ge- 
schrieben, in altem Prakrit, c. 2000 Jahre alt; etwa zwei Dutzend 
Kharoshthi-Documente auf Leder; eine ganze Serie von Manuscripten 
(Papier und Holz) in Brähmi-Schrift von nordindischem (Gupta) Typus 
und centralasiatischem Brähmi, theils Sanskrit, theils eine noch nicht 
näher festgestellte nichtindische Sprache enthaltend; altchinesische 
Documente auf Holzplatten und auf Papier; alttibetanische Manu- 
scripte ; Skulpturen, Malereien, ornamentirte Thonwaare, Siegel, Mün- 
zen, in reicher Anzahl, die letzteren vor allem von der chinesischen 
Han- Dynastie; Haushaltungsgegenstände und Industrieartikel ver- 
schiedener Art. Neben den sprachlichen Schätzen ist auch ein 
reiches Material vorhanden zum Studium der Ausläufer gräcobud- 
dhistischer Kunst. Sie ist selbst in den Ornamenten geschnitzter 
Holzstühle deutlich erkennbar. Besonders schön finde ich den Falten- 
wurf an den Gewändern der kolossalen Stuck -Relief- Figuren des 
Stüpa von Rawak. — Wichtig ist auch ein negatives Resultat der 
STEm'schen Expedition. Die zahlreichen Manuscripte und Holzdrucke 
in ,unbekannten Charakteren^ die in den letzten Jahren von Ost- 
turkestan herkamen, haben sich als dreiste Fälschungen erwiesen 
und ist der Hkuptbetrüger dem strafenden Arme der Gerechtigkeit 
nicht entgangen. 

Die englische Regierung, welche dies wichtige Unternehmen 
so umsichtig ins Werk gesetzt, verdient den wärmsten Dank der 
Gelehrtenwelt; dem energischen Forscher aber wünschen wir von 
Herzen Glück zu dem glänzenden Ergebniss seiner Bemühungen. 

L. V. SCHROEDER. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Cl 



03 



(T3 



2 5 



F P. 



u 

«4- ~° 

O <L> 



Finnisch-ugrische Forschungen. ( J1 

Finnisch-ugrische Forschungen, Zeitschrift für finnisck-ugrische Sprach- 
u nd Volkskunde, nebst Anzeiger, unter Mitwirkung von Fach- 
genossen herausgegeben von E. N. Setälä und Kaarle Krohn, 
Helsingfors (Red. der Zeitschrift), Leipzig (Otto Harrassowitz). 
Bd. i, Heft i und n, 1901. 

Die Finnländer haben sich die Theilnahme und Bewunderung- 
Europas, ja der ganzen gebildeten Welt durch ihr charaktervolles, 
wahrhaft heroisches Verhalten bei dem schweren, über sie herein- 
gebrochenen Geschick erworben. Ehrlich und tüchtig auf allen Ge- 
bieten, erwerben sie sich unsere Achtung auch durch die Gediegen- 
heit ihrer wissenschaftlichen Arbeit. Ein neuer rühmlicher Beweis 
derselben liegt in den ersten Heften der ,Finnisch-ugrischen For- 
schungen 4 vor, die wir mit herzlichster Sympathie begrüssen. 

Das erste Heft enthält an erster Stelle einen pietätvollen Ar- 
tikel aus der Feder Setäläs, dem Andenken des grossen Fennologen 
Castren gewidmet. Es folgt eine Darlegung des Planes der Zeit- 
schrift, welche das Gebiet der Fennologie in weitestem Umfang 
pflegen und auch für die so erwünschte Bibliographie desselben 
sorgen will. Setälä bespricht sodann die Transscription der finnisch- 
ugrischen Sprachen, Kaarle Krohn die Frage: ,Wo und wann 
entstanden die finnischen Zauberlieder ?' Die weiteren Artikel des 
ersten Heftes von Szinnyei, Wiklund, Wichmann, Mikkola, Ekmund, 
Simonyi, Donner, behandeln sprachliche Fragen aus dem finnisch- 
ugrischen und ural-altaischen Gebiete. Heft n bringt ausser einigen 
Besprechungen und Mittheilungen die Bibliographie der finnisch- 
ugrischen Sprach- und Volkskunde für das Jahr 1900. 

Wir wünschen dem ebenso patriotischen wie wissenschaftlich 
werthvollen Unternehmen den schönsten Fortgang und hoffen, dass 
dasselbe insbesondre in der deutschredenden Welt gebührend be- 
achtet werden möge. Dass die Finnländer sich hier der deutschen 
Sprache bedienen, giebt ihnen ein besonderes Anrecht darauf und 
bringt sie uns noch um ein ganzes Stück näher. 



CÜ 



t! öi 



O -ö 



w l 

fN CO 
f\l ^ 
, CD 

ö> 



o E 



CD 



F P. 



u 

«4- ~° 

O <L> 

*S 

'i/i öi 

CD ? 

> CD 

C CT 

=) O 

— o 



L. V. ScHROEDER. 



2 T5 

ifl tn 

£ -ö 

-ö v 

E-e 

E => 

fD CD 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

CD ^ 

C _Q 

CD 3 

ü Q_ 



Original fronn 



92 Karl Florenz. 

Dr. Karl Florenz, Japanische Mythologie. Nihongi ^Zeitalter der 
Götter', nebst Ergänzungen aus andern alten Quellenwerken. Mit 
Illustrationen. Tokyo 1901. 

Das erste und zweite Buch des Nihongi, der japanischen 
Annalen', bilden zusammen mit dem ersten Buche des Kojiki und 
einem Theile des Kujiki die Grundlage der Shinto-Religion, welche 
als die alte und ursprüngliche Religion Japans für die allgemeine 
vergleichende Religions- und Mythenwissenschaft von grösstem Inter- 

00 

esse ist. Herr Dr. Karl Florenz, Professor an der Universität zu 
Tokyo, welcher bereits früher den dritten Theil des Nihongi (die 

fN 

Geschichte Japans im siebenten Jahrhundert) nebst einer Einleitung 
deutsch veröffentlicht hat, bietet uns nun hier das erste und zweite 
Buch in deutscher Uebersetzung, nebst Ergänzungen aus dem Kojiki 

fN 

und anderen Werken, und macht uns damit die beste und wichtigste 
Quelle der altjapanischen Mythologie zugänglich. Sehr gründliche 
und eingehende Anmerkungen zu dem Text werden nicht nur dem 
Sprachforscher willkommen sein, sondern auch den vergleichenden 
Religionsforscher und Mythologen vielfach fesseln und anregen. Es 
ist zwar vor einiger Zeit eine vollständige englische Uebersetzung 
des Nihongi von W. G. Aston erschienen, das macht aber das Er- 
scheinen einer durchaus selbständigen Uebersetzung aus berufener 
Feder in deutscher Sprache nicht weniger wichtig und erfreulich, 
und jedenfalls haben wir Deutsche in erster Linie alle Ursache, 
Herrn Professor Karl Florenz für diese bedeutende Erweiterung 
unserer Kenntnisse von der altjapanischen Shinto-Religion dankbar 
zu sein. Auch wer des Japanischen nicht mächtig ist, spürt es bald, 
dass er hier von einem wirklichen Kenner des Gegenstandes in 
gründlicher Weise belehrt wird. Eine Anzahl von charakteristischen 






o -ö 



w I 

fN CO 

fN ^ 

, O) 

O o 

c v> 

o E 



ro 



F P. 



u 



und interessanten Illustrationen, welche dem Buche beigegeben sind, 
führen uns me 
im Bilde vor. 



führen uns mehrere der dramatisch lebendigsten Mythen anschaulich 

> 0) 
C CT 

=> o 
" ° 

Die Göttergeschichten des Nihongi zeichnen sich im allgemeinen 
durch grosse Originalität, ein speeifisch japanisches Gepräge, aus. Ich 

.E -ö 
-ö v 

E-e 

E => 

fO O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Japanische Mythologie. 93 

hebe in dieser Beziehung nur die sehr interessanten, dramatisch be- 
wegten Erzählungen von dem Sturmgott Susanowo hervor. Doch 
auch manche merkwürdige Analogie zu längst bekannten Mythen, 
Sagen und Sitten anderer Völker tritt uns, wie nicht anders zu er- 
warten, hier in der altjapanischen Mythologie entgegen. So gleich 
am Anfang der Mythus, nach dem Himmel und Erde vor alters 
nicht von einander geschieden, das männliche und weibliche Princip 
nicht getrennt waren. Wir kennen diese Vorstellung bei den Maori, 
die dieselbe sehr poetisch gestaltet haben. Sie liegt auch der vedi- 
schen Götterthat des Auseinanderstemmens von Himmel und Erde 
zu Grunde. Verwandte Vorstellungen bei noch manchen anderen 
Völkern hat schon Baron Andrian s. z. in seinem Vortrage über ,die 
kosmologischen und kosmogonischen Vorstellungen primitiver Völker' 
(München 1897) p. 5 flg. besprochen. Sind auch die Nebenumstände 
nicht dieselben, so ist doch die Uebereinstimmung in der Grund- 
vorstellung interessant und bemerkenswerth genug. Die Fahrt des 
Izanagi in den Hades zur Wiedergewinnung seines dort weilenden 
Weibes Izanami ruft uns manche verwandte Mythen fernab wohnen- 
der Völker ins Gedächtniss. Bemerkenswerth ist namentlich der Punkt, 
dass Izanami ,von Yomi's Kochherd gegessen', d. h. von der Speise 
der Unterweltsgottheit genossen hat und dadurch an jenes dunkle 
Reich gefesselt ist. Den Parallelen, die Florenz in der Anmerkung 
anführt, lässt sich wohl auch die Lotophagengeschichte anfügen. 

Die Schwanenjungfrauensage begegnet im Afumi-Füdoki (p. 305. 
306) in einer Form, welche nach Florenz Entlehnung aus Indien 
wahrscheinlich macht. Im Nihongi aber haben wir in mehreren Ver- 
sionen die Geschichte von Toyotomabime, welche einen durchaus 
genuin japanischen Eindruck macht und ein verwandtes Motiv zeigt, 
wie es auch in der Melusinensage, der Sage von Eros und Psyche, 
im Ojibway-Märchen vom Jäger und der Biber-Frau, in der indischen 
Geschichte von der Froschmaid Bheki u. s. w. erscheint (cf. p. 224, 
Anm.). Es ist die Liebe des Hiko-Hohademi zu der Meermaid To- 
yotomabime, die beim Gebursact nicht gesehen werden will, weil 
sie da die Gestalt eines Drachen, resp. eines Seeungeheuers annimmt. 

.E -ö 
-ö v 

E-e 

E => 

(ü <D 
in 4-/ 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



o -ö 

^ fl) 



w I 

, O) 
O u 



O o 

c v> 
o 2 



(T3 



2 5 



F P. 



u 

«4- "O 

O <L> 

CT 



94 K. Florenz, Japanische Mythologie. J. Takakusu. 

Der Mann verletzt das Verbot und nun kehrt sie für immer in ihre 
Meerheimat zurück. Hohademi aber trauert und klagt (p. 243): 

So lange die Welt besteht, 

Werde ich nie meine Geliebte vergessen, 

Mit der ich schlief 

Auf der Insel, wo die wilden Enten einkehren, 

Die Vögel der Tiefsee. 

Damit verwandt ist auch die Geschichte von Urashima aus dem 
Tango-Füdoki (p. 293 flg.). Urashima fängt eine fünffarbige Schild- 
kröte, die sich in ein wunderschönes Mädchen verwandelt. Es ist 
eine himmlische Prinzessin, deren Liebe nun den Finder beglückt 
Aber auch er verletzt eine Bedingung und verliert die Geliebte für 
immer. Uebrigens begegnet in dieser Erzählung auch das Motiv 
der Geschichte vom Mönch Petrus, resp. von dem indischen Räivata 
(im Vishnupuräna). Nachdem Urashima einige Zeit im Himmel bei 
der Geliebten geweilt, kehrt er auf die Erde zurück und findet nun 
hier alles verwandelt. Es stellt sich heraus, dass inzwischen über 
300 Jahre verstrichen sind. 

Wie diese und andere interessante Analogieen zu erklären sind, 
will ich hier nicht untersuchen. Das Mitgetheilte soll nur das Inter- 
esse der Leser auf die hochbedeutsame Publication von Dr. Florenz 
lenken. Ein wahres Kreuz bilden die langen und complicirten Namen 
der japanischen Götter, die sich schwer dem Gedächtniss einprägen 
lassen. Daran aber ist ja freilich der verdienstvolle Herausgeber 
des Buches nicht schuld. Ihm haben wir nur für seine reiche Gabe 






■o 

Q- 






(T3 



den aufrichtigsten Dank auszusprechen. 

L. V. SCHROEDER. 






U 






Takakusu, J., A Päli Chrestomathy with Notes and Glossary giving 
Sanskrit and Chinese Equivalents. Tokyo (Kinködö & Co.) 1900. 



2 1 

xciv + 272 S. 8 

— o 
ru 



o 



Immer weiter erstreckt sich der Kreis der internationale' der 



Wissenschaft. Seit Jahren sind wir gewöhnt, unter den Eingeborenen 

-ö v 

E-e 

E => 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original fronn 



A Pali Chrestomathy. 95 

Indiens geschätzte Mitarbeiter auf allen Gebieten der Indologie zu 
finden, und jetzt ist man auch in Japan eifrig bemüht, den wissen- 
schaftlichen Arbeiten abendländischer Forscher nicht nur volle Auf- 
merksamkeit zu schenken, sondern auch denselben ebenbürtige Lei- 
stungen an die Seite zu stellen. Dr. Jyun Takakusu, Professor des 
Sanskrit und der vergleichenden Sprachforschung in der kaiserlichen 
Universität von Tokyo, dem wir bereits die vortreffliche Ueber- 
setzung von I-Tsing's Record of the Buddhist Religion verdanken, 
und der auch schon durch mehrere wertvolle Aufsätze im Journal 
of the Royal Asiatic Society sich um die Erforschung der Ge- 
schichte des Buddhismus verdient gemacht hat, hat nun eine Päli- 
Chrestomathie herausgegeben, welche den Zweck verfolgt, das Inter- 
esse zunächst seiner eigenen Landsleute für die älteste Literatur 
des Buddhismus zu erwecken. Da wir aber merkwürdiger Weise 
bisher weder ein deutsches noch ein englisches Buch besitzen, welches 
geeignet wäre, Anfänger in die Päli-Literatur einzuführen, so kann 
diese japanesische Päli-Chrestomathie auch für Lehrer und Lernende 
an europäischen und amerikanischen Universitäten bestens empfohlen 
werden. 

Die Auswahl, die Takakusu getroffen hat, ist eine ganz vor- 
treffliche, indem sie sich auf alle Gebiete des Buddhismus erstreckt 
und , Buddha, Dhamma und Safigha' gleichmässig berücksichtigt. 
Der Anfänger findet hier Texte, die sich auf die Grundlehren des 
Buddhismus (Dhamma) beziehen, aus dem Parittaip (saranagama- 
nam, dasasikkhäpadäni, sämanerapaflhani, mettasuttarri, saccavibhan- 
gasuttarrty etc.), Discussionen über buddhistische Lehren aus dem 
Milindapanho und zum Schlüsse noch einige, aus dem Dhamma- 
pada und anderen Werken zusammengestellte, für Buddha's Lehre 
charakteristische Gäthäs. Er findet ferner Stücke aus dem Kamma- 
väcaip, die sich auf das Ritual der Kirche (Safigha) beziehen und 
von der Einweihung des Novizen, von der Uposatha-Ceremonie, von 
der Gewändervertheilung, von der Wahl eines Thera u. dgl. m. han- 
deln. Selbstverständlich ist auch das Leben des Buddha berück- 
sichtigt, indem Auszüge aus dem schönen Mahä-parinibbäna- 



CÜ 






U -ö 
^ fl) 



w I 

fN CO 

, O) 

° m 



o 2 



§ s 



F P. 



u 

«4- ~° 



CD , 

> <U 

=> O 

— o 



2 T5 

£ -o 
-o v 

E-e 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



96 J. Takakusu, A Pali Chrestomathy. 

suttarp gegeben sind. Die Jätakas sind durch eine Auswahl von 
sechs hübschen Geschichten vertreten. Und endlich findet der An- 
fänger auch einige Stücke aus dem Cullavagga des Vinaya-Pitaka 
und aus der Samantapäsädikä (dem Commentar zum Vinaya), die 
ihn in die Geschichte des Buddhismus (die Conzilien, die Be- 
kehrung des Königs ASoka u. s. w.) einzuführen geeignet sind. Den 
Texten (pp. 1 — 127) sind wertvolle Anmerkungen (pp. xi — xciv), 
meist Erklärungen buddhistischer termini, Auseinandersetzungen über 
buddhistische Lehren und Bräuche und literarische Nachweise ent- 
haltend, vorausgeschickt. Ein vollständiges Glossar (pp. 133 — 272), 
in welchem für jedes Wort sowohl die englische als auch die japa- 
nesische Bedeutung, ferner die Sanskrit- Aequivalente und bei buddhi- 
stischen terminis auch die chinesischen Transcriptionen und die ma- 
häyänistischen Aequivalente beigegeben sind, beschliesst das nütz- 
liche Buch. 

Ich weiss nicht, ob Takakusu ein specielles Werk zur Ein- 
führung in die Päli- Grammatik beabsichtigt. Wenn das nicht der 
Fall ist, so wären vielleicht ein kurzer Abriss der Päli-Grammatik 
und auch einige grammatische Bemerkungen zu den Texten für eine 
zweite Auflage, die das Werk hoffentlich bald erleben wird, sehr 
nützliche Beigaben. Auch würde ich in einer zweiten Auflage den 
Dhammapada und namentlich die für den volksthümlichen Bud- 
dhismus so charakteristischen Jätakas gerne in etwas grösserem 
Maasstabe ausgezogen sehen. 

Möge das Buch seinen Zweck erfüllen und dem Studium des 
Päli und des ältesten Buddhismus in Japan viele Freunde gewinnen 
und der zum Andenken an Max Müller gegründeten japanesischen 
Gesellschaft zur Förderung buddhistischer Forschungen (Society of 
Buddhist Research) tüchtige und arbeitsfrohe Kräfte zuführen! 

u 

«4- "ö 

M. WlNTERNITZ. 

■h! — 
'i/i öi 

> <U 
C CT 
=> O 

— o 

c O 

CO 

£ -o 
-ö v 

E-e 

E => 

ro <V 

cn x: 
in -m 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

o3 £ 

ü Q_ 



CÜ 



t! öi 

.C o 



^ fi) 



w I 

fN U) 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



Kleine Mittheilungen. 






(T3 



2 5 



Zur Maiträyani Samhitä. — Im Folgenden biete ich einige 
Conjecturen zu diesem von v. Schroedbr veröffentlichten Texte an; 
wenn sich unter meinen Verbesserungsvorschlägen der eine oder an- 
dere vorfinden möchte, der schon von anderen Gelehrten vor mir 
gemacht ist, so bitte ich um Entschuldigung, da ich nicht alle die 
von Delbrück, Roth und a. gemachten Conjecturen kenne. 

1. Zu ii. 1. 2 (S. 3, 7). Ohne Zweifel ist statt anena räjtiemän 
yavän vrlhln vädadhlya zu lesen: vädadlya: ,möge ich in meinen 
Besitz erlangen', vgl. Käth. ix. 3 (S. 127, 14). 

2. Zu ii. 1. 3 (S. 5, 10). Statt tarrt nah saha ist tan (d. h. tad) 
nah saha zu lesen, vgl. Käth. x. 2 (S. 126, 4). 

3. Die Interpunction von n. 1. 5 (S. 7, 9) ist so zu ändern: ki- 
läsatväd vä etasya bhayam; ati hy apahanti, vgl. Käth.xi. 5 (S. 150, 4): 



tfvaras tu tad ati duScarmaiva bhavitoJj. 

4 u 
o y 

™ - 

O o 

c v> 
o 2 



4. Zu ii. 1. 6 (S. 7, 18). Es ist hier wohl dvitiyam asya loke 
janayeyam statt janeyam zu lesen, vgl. Käth. xi. 5 (S. 150, 15): dvi- 
tlyam janayati. 

5. Zu ii. 1. 8 (S. 9, 14 und 15). Statt mryeta ist beide Male 
dlryeta zu lesen: ,wenn der Krug einen Riss bekommt'. 

6. ib. (Z. 19). Dass mit M3 und B statt des von v. Schroeder 
aufgenommenen svenaivainäm payasäcchaiti zu lesen sei svenaivainän 
payasäcchaiti, wird durch Käth. x. 11 (S. 138, 14) erwiesen. Die 
Maiträyani Stelle bedeutet: ; die Milch, welche die scheckige Kuh 



_N 
'-I-J 
'Ol 

£ =9 
> <u 

gab, wurde Fennich. Die scheckige Kuh ist ja die Erde oder die 

ru 



Stimme (vac), die Fennich ist die Feuchtigkeit (Milch) der Erde: 
mit ihrer eignen Milch nähert er sich also den Maruts (da diese 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 7 

o "c 

E => 

in 4-/ 
$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



98 Kleine Mittheilungen. 

bekanntlich die Kinder der scheckigen Kuh sind)', vgl. die citierte 
Käthaka Stelle und Taitt. S. n. 2. 11. 4: maruta eva svena bhägadhe- 
yenopadhävati. 

7. Zu ii. 1. 9 (S. 10, 20). Richtig ist nicht die Lesart von M3 
sondern die der anderen MSS.: yadi kämayeta kalpetety, ete eva 
havisl nirupya yathäyatham yajet; kdlpate ha. 

8. Zu ii. 1. 10 (S. 12, l). Zu trennen ist: tasmäd evädhi vra- 
tam älabhate. Wenn ich mich nicht irre, bedeutet das Brähmana: 
,den Göttern zugeführt (änlto devänäm) ist derjenige, der die sacralen 
Feuer gegründet hat: Deshalb soll er nicht weinen, denn auch die 
Götter weinen nicht. Agni nun ist unter den Göttern der Gelübde- 
träger (vratabhri). Zu Agni ist sein Gelübde gegangen (nl. das Ge- 
lübde dessen, der geweint hat), von ihm übernimmt er es (bekommt 
er es wieder zurück, sodass er wieder vratya wird)'. Danach ist 
das Wort adhivrata (Pet. Wörterb. in kürz. F. add. 4) zu streichen. 

9. Zu n. 2. 6 (S. 19, 13). Was sollen die Worte devä anyo 
'nyasya srls; te tisthamänä§ caturdhä vyudakräman bedeuten? Ich 
fürchte, dass hier eine etwas gewaltsame Textesänderung erfordert 
ist. und schlage vor zu lesen: devä anyo 'nya&ya Sraisthyäyätistha- 
mänäS caturdhä vyudakräman. ,Als die Götter der eine des andern 
Vorrang nicht dulden wollten, da schieden sie sich in vier Partieen', 
vgl. TS. ii. 2. 11. 5. 

10. Zu ii. 2. 10 (S. 23, 14). Es ist natürlich indräya vai mr- 
dhäya in indräya vaimfdhäya zu ändern. 

11. Zu in. 6. 1 (S. 59, 15 flgg.). Zu lesen und abzutheilen ist 
präclnavamiant kurvanti; diso yad imä (so alle MSS.) vyakalpayan. 
Es ist ja im Folgenden nicht von der Vertheilung der Erde die Rede, 
sondern von der Vertheilung der Himmelsgegenden. Ferner ist hinter 
prävasyati (S. 60, 4) und hinter dhftah (S. 60, 7) ein Interpunctions* 
zeichen anzubringen. 

12. Zu in. 6. 8 (S. 70. 12). Der von v. Schroeder gedruckte 
Text lautet : ydjusä kandvyate ; ydjusä hi manusyäh kandüydnte 
vyävfttyai. Zweifellos hat man mit allen MSS. und Einfügung eines 
Avagraha zu lesen: ydjusä kandüyate; 'yajiisä hi manusyäh kandü- 



t; öi 



3 * 

^ (D 

m </» 

° ^i 

fN CO 
f\l ^ 
, O) 

o y 

O o 

c v> 
o E 

^-^ 4-1 

TD ±3 

> ^ 

£ ö. 

P 

U 

«4- ~° 

O <L> 

*S 

■h! ■— 

'i/i öi 
s_ 

<U , 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 
ro <u 

1 i Digiliz&d by VjOOgle CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 






w I 

f\l ^ 

, O) 

^ U 

O o 

c w 

o 5 



ru 



$ 5 



F P. 



Kleine Mittheilungen. 99 

ydnte: vyävrttyai, d. h. ,mit einem Yajus juckt er sich (beim Opfer), 
ohne Yajus jucken sich ja die Menschen (im gewöhnlichen Leben) : 
um einen Unterschied zu machen (zwischen Geweihtem und Profanem)', 
vgl. weiter (S. 70. 14): yad ayajüsä kandüyeta: ,wenn er sich ohne 
Yajus juckte'. Falsch überliefert muss der Accent von ydjusä in 
in. 6. 9 (S. 72, 8) sein: es ist wohl zu lesen: 'yajusä hi manusyä 
avanenijati. 

13. Zu m. 8. 4 (S. 98, 6). Was sich der Herausgeber gedacht 
hat bei seiner Lesart praibhyau lokebhyo bhrätrvyarß nudate, ist mir 
unersichtlich, da mir das handschriftliche praibhyo lokebhyo ganz 
richtig scheint. 1 

14. Zu in. 8. 4 (S. 98, 20). Statt nirvaske ist natürlich nirvraske 
zu lesen; ein Druckfehler ist käya statt kärya (S. 99, 2). 

15. Zu iv, 1. 9 (S. 12, 3). Statt krüram ärksyämahä und krü- 
ram ärksadhvä ist zu lesen krürarji märksyämahä resp. märksadhvä; 
das Richtige wäre mraksyämahe und mraksyadhve. Ebenso findet 
sich in Päraskaragjhs. n. 6. 17 pramärksyate. Das ä ist wohl zu er- 
klären als übertragen aus den starken Formen des Singulars märsti] 
auch Käth. krürasmätksyämaha ist offenbar aus krüram mräksyämaha 



entstellt 

3 * 



16. Zu ib. (S. 12, 8). Die ganze Stelle ist so zu lesen und zu 
interpungiren : te devä atimrjänä äyant; süryäbhyudite te "mrjata; 
[yarh suptam süryo "bhyudeti] süryäbhyuditah süryäbhinimrukte ; 
süryäbhinimruktah syävadati; syävadan kunakhini; kunakhy agre- 
dadhusy; agredadhufj. parivitte; parivittah parivividäne; parivivi- 
däno virahani; virahä bhrünahani; bhrünahanam eno nätyeti. Dass 
diese Interpunction die richtige ist, beweist Taitt. Br. m. 2. 8. 12. 

17. Zu iv. 1. 10 (S. 14, 8). Statt des vom Herausgeber auf- 
genommenen präncau bähü nayati schreiben alle MSS. bähünnayati, 

1 ^KJT ist ein bedauerlicher Druckfehler für ^Nnf; da Caland hier gar keine 
Accente setzt, wird der Fehler der Mss. nicht ersichtlich ; sie schreiben TP^m, wobei 
der Accent des Pronomens weggefallen ist (ebhyds, prd ebhyo lokdbhyo)] die Ueber- 
lieferung musste also corrigirt werden und es ist nur zu bedauern, dass die Correc- 
tur durch einen sinnlosen Druckfehler entstellt wurde. L. v. Öchroeder. 

7* 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 






100 Kleine Mittheilungen. 

ganz richtig, wenn man nur auflöst: bähü unnayati, vgl. Taitt. Br. 
ni. 2. 9. 9 : präficau vedyamsäv unnayati. Dass Zusammenrück ung 
mit einem Pragfhya nicht unerhört ist, beweisen die Belege bei 
Wackernagel, Altind. Grammatik § 270. b. Anm. 

Breda, 28. October 1901. W. Caland. 

Eine Einzelheit aus dem altindischen Familienleben in volks- 
kundlicher Beleuchtung. — Zimmer schreibt in seinem Altindischen 
Leben, S. 327 : ,Es erscheint besonders das Verhältniss der Schwieger- 
tochter zu ihrem Schwiegervater als das der grössten Ehrfurcht an 
einigen Stellen: „ Welche (Dämonen) vor Sürya sich verkriechen 
(wegschleichen pra-sarp) wie die Schwiegertochter (snushä) vor 
dem Schwiegervater" A. V. 8, 6, 24; vgl. Ait. Br. 3, 22. — Käth. 
12, 12 (Ind. Stud. 5, 260) wird als Höhepunkt der durch Surägenuss 
erzeugten Trunkenheit und als Verletzung jeglicher Sitte angeführt, 
dass Aeltere und Jüngere, Schnur und Schwiegereltern zusammen 
schwatzend dasitzen. Vergleiche auch T. Br. 2, 4, 6, 12 asya snushä 
gvagurasya pragishtim sapatnä väcam manasä upäsatäm.' — Nun 

scheint mir das von Zimmer dem Verkriechen der jungen Schwieger- 
fc =3 

tochter untergelegte psychologische Motiv nicht sehr wahrscheinlich. 
In Indien war es wohl wie überall auf der Welt contra bonos mores, 
seine Ehrfurcht durch , Wegschleichen' zu bezeugen. Deshalb 
stimmt die von Zimmer angeführte T. Br.- Stelle, die wie viele andere 
von der Pflicht des Gehorsams der Schwiegertochter dem Schwieger- 
vater gegenüber spricht, meines Bedünkens nur schlecht zu den un- 
mittelbar vorausgehenden. Dass es sich bei dem Fortlaufen der 
Frau vielmehr um eine conventioneile Manier handelt, geht aus Ait. 
Br. 3, 22 mit der formelhaft klingenden Wendung ,tad yathä eva 
adah snusä gvaguräd lajjamänä nillyamänä eti' und noch mehr aus 

o v 

dem Säyana-Commentar sehr klar hervor, der folgendermaassen pa- 
raphrasiert , [yathä] anücänänäm lg an am vä gphesu yavatih snusä 
gvaguram drstvä tasmäd lajjamänä lajjäm präpnuvati nillyamänä 
vastra-ava-gunthana-hasta-ädi-afiga-sarhkocena tirohite vasati grha- 
abhyantaram ägacchati, evam eva . . . / Also: ,Wie in den Häusern 
E-e 

E => 

fD O) 

- "I n , li7ö , hu ( Original frorn 

| S Digmzed Dy ^uu^lL CORNELL UNIVERSITY 

C _Q 

ü Q_ 



o -ö 

^ fl) 



w I 

fN «/) 

, O) 

O u 






O E 



ru 



2 5 



F P. 



(U 

_N 
'-I-J 

> <u 

C CT 
=) O 

— o 

c O 

fD 



Kleine Mittheilungen. 101 

von Vedagelehrten oder Machthabern die junge Schwieger- 
tochter, wenn sie des Vaters ihres Gatten ansichtig wird, vor ihm 
voll Scham sich versteckt, d. h.: unter Verbergung ihres Körpers 
durch Kleidung, Schleier, Hände u. s. w. in das Innere des Hauses 
hineinläuft, gerade so . . .' — Dass es sich ebensowenig um eine 
etwa durch das indische Haremswesen aufgezwungene Prüderie wie 
um eine Ehrfurchtsbezeugung handelt, geht nicht blos aus der Er- 
wägung, dass diese Prüderie dem nahen väterlichen Verwandten 
gegenüber am wenigsten markant sein müsste, sondern namentlich 
aus dem genauen Parallelismus der von Zimmer namhaft gemachten 
Stellen hervor: nicht vor jedem Manne verbirgt sich die Frau, son- 
dern gerade vor dem Schwiegervater und jedenfalls nur vor diesem. 
Und dieses Sich -Verhüllen ist so augenfällig, so typisch, dass es zum 
symbolischen Ausdruck einer Schamhaftigkeitsempfindung, eines Sich- 
Verbergens gemacht; dass ein Ueberschreiten dieses Anstand sgesetzes, 
ein gemeinschaftliches Plaudern der beiden nahen Verwandten, 
zum Prototyp der Sittenlosigkeit gemacht werden kann. Woher 
kömmt dies? Ich glaube, man wird sich lange vergeblich bemühen, 
die Lösung des Rätsels zu finden, wenn man es verschmäht, die 
allgemeine Völkerkunde um Rath zu fragen. Man könnte leichtlich 
eine reiche Anzahl theoretischer Erwägungen anbringen, die mehr 
oder minder Wahrscheinlichkeit für sich haben. Immer wird die 

o u 

Basis der Exegese eine subjective bleiben müssen, solange wir 
nicht zur Objectivität des thatsächlich im Völkerleben Vorhan- 
denen fortschreiten. Hier aber scheint mir die sich bietende Ant- 
wort eine so exacte zu sein, dass sie schwerlich ernsteren Wider- 
spruch zu befürchten haben w T ird. 

Starcke bezeichnet es in seinem Buche über die primitive Fa- 
milie in ihrer Entstehung und Entwicklung, Leipzig 1888 S. 253, als 
eine nicht ungewöhnliche Sitte, dass Schwiegereltern und Schwieger- 
kinder mit einander nicht frei und ungezwungen verkehren dürfen. 
Tylor hat in seiner Early History of mankind schon diese Sitte 

<D 

besprochen und viele Beispiele derselben citiert ... In einigen 
Fällen trifft das Verbot beide Schwiegereltern sowie den Schwieger- 



T3 



V öl 



o o 

c ^ 
o 2 



- "r? 

F P. 



u 

«4- ~° 

O <L> 

'i/i öi 

£ ? 

> <U 

=> O 



fD 

i/> tn 

£ -ö 
-ö v 

E-e 

E => 

fD <D 
w .c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



102 Kleine Mittheilungen. 

söhn und die Schwiegertochter, in anderen Fällen gilt es nur für 
einzelne von ihnen. Bald darf der Schwiegersohn nicht die Schwieger- 
mutter anreden, bald die Schwiegertochter nicht dem Schwie- 
gervater vor die Augen kommen. Alberti erzählt von den 
Bechuanen, dass der Schwiegervater nur in der Gegenwart anderer 
mit seiner Schwiegertochter zusammentreffen dürfe. Ueberhaupt darf 
bei den südafrikanischen Stämmen nach Fritsch, Die Eingeborenen 
von Südafrika 114, die Schwiegertochter ihren Schwiegervater und 
seine männlichen Verwandten in aufsteigender Linie weder ansehen 
noch mit ihnen Zusammensein noch selbst ihren Namen aussprechen. 
Sehr häufig ist die Annäherung des Schwiegersohns an die 
Schwiegermutter, bisweilen aber auch die der Schwiegertochter an 
die Mutter des Mannes verboten. — Fritsch a. a. O. erklärt mit 
Alberti das von ihm erwähnte Tabu als eine Folge der Furcht vor 
Blutschande und Starcke stimmt dieser Erklärung bei; freilich bringt 
auch er mit Zimmer das Motiv der Ehrfurcht als Erklärungsgrund 
an, aber doch nur insofern als sie eine traditionell gewordene und 
dadurch abgeschwächte Furchtempfindung ist. Lubbock, der in seiner 
Sociologie S. 111 Beispiele für die berührte Sitte giebt, erklärt sie 
als Rest der Raub-Ehe. Für Indien ist diese Erklärung entschieden 
zu verwerfen. Hat es doch erst spät (in der räksasa-viväha) die 
Raub- Ehe quasi als Rechtsinstitution gekannt. Doch mag ich jene 
Exegese überhaupt nicht gelten lassen. Sobald durch den Raub der 
Frau dieselbe dem neuen Hauswesen einverleibt war, musste die 
Ehe auf diesem so gut wie auf irgend einem anderen Mittel der 
Erwerbung des Weibes consolidiert gewesen sein. Unmöglich konnte 
der Rachekrieg zwischen Eltern und Schwiegerkindern als Sitte 
sanetioniert, die geheiligte Institution der Ehe dadurch gefährdet und 
ihrem Wesen nach negiert erscheinen: Für die heissblütige Indierin 
mag die Warnung vor dem Umgang mit einem vielleicht noch sehr 
jungen Schwiegervater aber nicht minder berechtigt gewesen sein 
als die beständigen Verwarnungen des angehenden Vedagelehrten 



■o 



ö. 2> 



Cl 



03 






(T3 



F p. 



Ü =5 



=> o 

— o 



vor der Todsünde des Concubinats mit der Frau des eignen Lehrers. 

(- fü 

Julius von Negelein. 

£ -o 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 

ü Q_ 



Original from 






Critical Remarks on the Text of the Divyavadana. 

By 

J. S. Speyer. 

This paper aims to put forth some observations and suggestions 
about the text of the so called Divyävadäna, namely that collection 
of Buddhist legends of various authors which has been edited by 
Cowell and Neil, Cambridge, 1886. In doing which there is not 
the least disposition to derogate from the merits of both scholars 
who have deserved of the gratitude of every Student of Sanskrit 
Buddhist literature for their excellent editio princeps. Their task, 
hard and heavy in itself, if we take only into account the condition 
of the text, mutilated and ill-treated as it appears to be in many 
respects, was rendered more difficult by the fact that they had to 
work upon modern mss. going back to one source, a Nepalese MS 
of the xvn tb Century, still extant but inaccessible to the editors, see 
their Preface, p. vn. This State of things may justify a new attempt 
of restoration of some passages by means of conjecture. For al- 
though the editors display throughout a laudable cautiousness in con- 
stituting the text, which makes them sometimes retain questionable 
forms and even obvious corruptions noticed as such in the notes with 
the sign 'Sic MSS', even now and then in such cases as where the 
reader might feel inclined to put into the text a necessary and 

3 o 

almost certain correction — yet, on the other hand, in sundry other 
cases their practice shows them to have the persuasion, that a judi- 
cious employment of conjectural criticism is legitimate and may turn 



■o 



(T3 






(T3 

jc 



u 

O <L> 



£ -o 
-o v 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 

E =3 

ft3 <D 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original from 



104 J. S. Speyer. 

out a useful and efficacious remedy. Of the kind is their excellent 
emendation tüpättesu 1 for the unmeaning bhü (or tu) päntesu of mss. 
in the common-place about the inevitability of the fruit of previous 
actions (see p. 54 n. l). So on p. 284, 24. 319, 25. 422, 6. 562, 19 
etc. Sometimes the corrections modestly kept back in foot-notes 
ought to have been put into the text, e. g. p. 26 n. 2 vastra-, cp. 
the parallel passage 3, 19; — p. 172 n. 4 vithim; — p. 204 n. 1 
pratisthitah, the confusion of visarga with the vertical stroke of ä 
being not uncommon in Nepalese mss.; — p. 210, n. 7 käladhar- 
mena' — p. 349, n. 1 buddhakäryam karisyati; — p. 519, n. 10 
sahtäm* — p. 555, n. 3 sasyasampanna. 

The general condition of the language of our tales, however, 
recommends circumspection and wams against temerity in critical 
experiments. Though thejr are generally written in tolerably good 
Sanskrit, though less pure than that of the Avadänasataka, there is 
difference of correctness in the different tales, which have not the 
same provenience, indeed. Soine of them abound in präkriticisms, 
and a good many of metrical compositions are obviously sanskritized 
reproductions of stanzas in some populär dialect. It is clear, for in- 
stance, that in the famous two älokas 2 which begin with ärabhadhvam 
niskrämata (p. 68, 19. 138, 26. 162, 21. 266, 10. 300, 21. 547, 21. 
569, l) the gen. mrtyunah rests on an original maceuno and that 
natfägära iva kunjarah, the fourth hypermetrical päda is a clumsy 
transposition of präkritic nadägäro va kunjaro. Likewise, the nar- 
rations concerning Asoka, especially the ns. xxvi and xxvn con- 
tain sundry instances of what we may call metaphrastical San- 
skrit. But, outside the metrical portions, too, barbarous forms axe 
not wanting. Such cases may be embarrassing for editors, inasmuch 
as they have not always the means for ascertaining how great a 
share in those irregularities is to fall on the maker of the tale, and 
how much must be put into the account of copyists. That the edi- 






03 



<=> o 



CD 



1 I follow here throughout the System of transcription of the Grundriss, not 



=> o 

— o 

CO 

that of the editors. 

3 Cp. Jou?mal Asiatique^ ix e s., t. xn, 208. 

'-o v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



CRITICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 105 

tors of Divy. have admitted the barbarism grakäya = classic grhltvä, 
will be right, I suppose, for this form occurs often enough, especially 
in the Aöoka-tales, to be holden for that used by the author; but 
how to realize e. g., whether p. 380, 2 ksantum, the correct infin. 
and so given in MSS, but sinning against the metre, represents the 
hand of the maker of the avadäna rather than Ichantum, as is prc- 
posed by the editors on p. 708, which serves the metre but is no 
Sanskrit at all? Instead of sahäya ,comrade', we often meet with 
sahlya at the end of Compounds; whether owing to clerical error or 
were it the authors who did use that singular form? The editors 
have sometimes corrected -sahäya (p. 389 n. 2), sometimes retained 
-sahlya (p. 312, 5. 446 ; 3 and 5). For the rest, -sahlya is also 
found elsewhere in Buddhistic Sanskrit, see Buddhacarita 10, 26, 
cp. Windisch, Mära und Buddha p. 276 n. 3. 

On the other hand, the numerous repetitions which are so fre- 
quent in Buddhist writings not rarely afford a welcome help. Of 
two variants in the same formula it will sometimes happen that one 
represents the right reading, another the corrupted or interpolated 
one, and many times it is evident which of the two everywhere is 
to be put into the text If in an often recurring simile it is said 
that somebody feil on earth senseless like an uprooted tree, it is 
clear that it must be mülanikrtta iva drumali, even though MSS 
have here almost always mülanihrnta. P. 199, 14 the editors insert 
hall before pratyayah for no other reason but its regulär appearance 
in parallel places. 1 In this manner they have often improved the 






o -ö 

3 * 



w i 

fN CO 

° m 



c v> 
o E 



§ i 

1 In the additional ,Notes and corrections' p. 703 the editors have justly 
corrected nispurusena for nispai-usena, the form they admitted into the text (p. 3, 
24. 4, 1. 442, 13. 460, 4) and explained by 'soft 1 (p. 682). The second part of the 
Compound cannot be but a Substantive. The corresponding passage in Mahavagga 
1, 7 so vassike päsäde cattäro mäse nippurisehi turiyehi paricäriyamäno na het^hä 
päsäda ärohati etc. shows also the right way of interpretation. Since prince Yaso 
awaking from his sleep has about him female Company with musical intruments in 
different attitudes asleep, it is piain that nispurusäni türyäni means a female or- 

<£ <u _ 

chestra*. Cp. Feer, Ann. du Mus. Guim. xvm (translation of the Avadana^ataka), 
in tn 

219 n. 2. 

T-5 CD 

8* 

E => 

fD O) 

10 X-> 

$£ 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original from 






106 J. S. Speyer. 

transmissed text by availing themselves of the evidence given in re- 
petitions of the same formulae. There remain, however, some pas- 
sages still in need of correction by employing this method. 

A Sanskrit text in the Latin aiphabet is liable to a special 
kind of errors of print: Omission of the sign of prosodical length or 
its Standing above the wrong syllable. In most cases, where this has 
happened in our edition, the fault is of no consequence, as every 
one will make the necessary correction of himself. Now and then, 
however, there arises some doubt whether one has to do with a 
printing fault at all. Manuscripts often confound janapada 'country' 
and janapada f country-people\ In Divyävadäna there are several 
instances of janapada in the edition in such cases as where the con- 
text requires jäna-. So p. 224, 4; 22. 243; 3. 245, 2. 426, 7. 469, 
24. In all of them we must correct janapada. — P. 169, 12 and 
174, 9 we meet with the avyayibhäva karunädinavilambitäksaram. 
The right form is karunadlna , the former part of the Compound 
being an adjectival dvandva (karuna -f- dina + vilambita) and thus 
must be corrected. On p. 449, 10 and in several passages of the 
Avadänasataka short a has been preserved intact. 

After these short general remarks put down beforehand in 
order to clear the way for the subsequent critical observations, I 
will now proceed to them, following the order of the work. 

o P 

I (Kotikarnävadäna). 

o E 

I. P. 4, 4. The householder Balasena, being asked by his son 
why he is always so intent on ploughing his land, answers some- 
thing like this : c if I were to spend my life-time in as idle a manner 
as you, my son, I soon should lose my fortune.' On this reply the son 
feels uneasy: sa samlakshayati \ mamaivärtham codanä kriyate. It 
is Strange and against the fixed norm of Sanskrit composition that 
no demonstr. pronoun is added to codanä; moreover mamaivärtham 
is here out of place, nobody eise being opposed who could be ex- 
horted but the l st person. I read: mamaiveyam codanä kriyate. In 
Nepalese mss. -ärthairi and -eyarn may easily be confounded. 



T3 



ö. 2> 



■o 



= 1 

F P. 



u 



<U 



c 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



CRITICAL ReMARKS ON THE TeXT OP THE DlVY AVADANA . 107 

II. P. 4, 22. Father Balasena instructs his son Kojikarna that he 
must stay in the midst of his caravan, that place being safest against 

robbers: yadi balaväm§ cauro tvayä särthasya madhye gart- 

tavyarii. The sequel of the sentence na ca te särthavähe hatah sär- 
tho vaktavyah is corrupt and nonsense. I restore it in this manner: 
na ca te särthikebhyah soWtho vaktavyah, ,but you must not teil 
it to the merchants (viz. that you will take your place in the centre 
and why)'. As to so Wtho, confusion between ä and o is frequent in 
Nepalese niss., the o after a consonant being commonly denoted by 
the stroke of the ä and the undulating horizontal stroke at the top 
of the aksara. For this reason on p. 2, 27 read uttunganäso for °sä, 
cp. 26, 4. — Inversely, o is corrupted out of ä p. 352, 29; read: sä 
Väsavadattayä cocyate. Cp. also infra, nr. xlviii. 

III. P. 8, 8. In the words of the Preta, after aho bata the con- 
junction yadi need be inserted, cp. the parallel passage 9, 8. 

IV. P. 9, 25. Kotikarna sees at sunrise the heavenly chariot dis- 
appearing with the four heavenly nymphs and the man who had 
received him with hospitality, and instead of them four dogs who 
are ill-treating the man, tearing open his back and devouring his 
flesh. Here the words tävat prsthavaniSän utpätyotpätya are unin- 
telligible. That prsthamämsän is the right reading appears from 
10, 2 foll., where the karmaploti is given. 

V. P. 17, 18. Kojikarpa returning home finds his parents who 
had become blind during his absence, but now on getting back their 
lost son recover the sight. It is this they teil him: puträväm tva- 
diyena Sokena rudantäv andhibhütau \ idänim tvam evägamya caksuh 
pratilabdham. Here tvam is an error either of MSS or printing. 
We have to read tväm. In the avadäna-texts the accus, of the ob- 
ject with ägamya is the proper expression to State that something 

o v 

good or evil has been obtained c by means of an intervening person. 
Cp. p. 95, 9 = 309, 29 yä käcid asmäkam Srlsaubhägyasampat sarvä- 






O -ö 
^ fl) 



w I 

fN tO 

r\l ^ 

, 0> 

O o 

c v> 

o 2 



CO 



2 5 



20. 171, 14. 173, 16. 188, 6; 20. 269, 16. 347, 17. 404, 25 and 



'Ol 

> <u 

C öl 

sau Buddham Bhagavantam ägamya. Other instances are on p. 170, 

several places in the Avadänaäataka. Likewise p. 350, 16, where 

E-e 

E => 

CO 0) 

10 X-> 

$£ 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

CD 3 

ü Q_ 



Original from 



108 J. S. Speyer. 

the text, as it is found in MSS, yat kirricid asmäbhih äreyo 'väptam 
tat sarvam imarri markatam ägamya is sound; the editors by 
printing ägamyät corrupted a faultless text instead of correcting a 
corrupted one. The gen. with ägamya (405, 10) must accordingly 
be erroneous, I suppose it must be read there yusmän ägamya. 

II (Pürnävadäna). 

VI. P. 27, 6. From the context it is piain that thus is to be 
connected: Pürnenäpi tatraiva dharmyena nyäyena vyavaharatä 
sätirekä suvarnalaksä samudänttä, cp. Burnouf's translation (Intro- 
duction p. 238 of the origin. edit., 1. 23 — 25). In the preceding sen- 
tence the visarga both after suvarnalaksä and sarrtvrttä must, of 

6 

course, be removed. 

VII. P. 28, 19. The maid-servant of Bhavila's wife going at 
Pürna's in the proper time receives the housekeeping-money quickly, 
the other two girls Coming in an unfit moment must wait a long 
time. This is the content of the following sentences, thus edited: 
sä kälam jnätvä gacchati Stghram labhate \ kanyäi cirayanti. As sä 
is opposed to the other two, not kanyäs is wanted but anyäs. Cp. 
Burnouf's translation 1. 1. p. 241, 4. The use of the plural is one of 
the inaccuracies proper to the dialect of this kind of literature. So 

avad. i (17, 10) te gacchanti te kathayanti — with te are 

meant mätäpitarau. P. 23, 10 tais instead of täbhyäm. In nr. xm 
(p. 170, 16) Svägato 'harn cävasthitäh against grammar, which re- 
quires °sthitau. In nr. xxvn Kunälävad., p. 406, 4 foll. the plur. na- 
yanäni is repeatedly said of the two eyes of the bird kunäla and 
of the prince of that name. Yet, p. 29, 1 the dual is properly used: 
te anye api svämibhyäm pfste kathayatah. 

VIII. P. 33, 1. As the ablative cannot by any means express 
l to seil to', Pürnasyäntikäd vikriya need be corrected into °tike vi- 
krlya. The locative duly Stands p. 33, 5 and 32, 28. — Inversely, 
the ablative ought to be restored p. 238, 1 and 7 iakatäd grhltvä; 
on both places MSS and the edition have iakatam against grammar 



Q. 



w i 

fN tO 

f\l ^ 

O u 



O o 

c v> 
o E 



(T3 



2 5 



F P. 



u 



> <u 

C CT 

=) o 

— o 

c O 

and sense. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



ti öi 



Cl 



03 



F P. 



u 

«4- "ö 

O CL) 

'i/i öi 

£ ■? 

> <U 

3 O 

' O 






03 



03 



CRITICAL REMARKS ON THE TeXT OF THE DlVYAVADANA. 109 

IX. P. 41, 16. Owing to one superfluous aksara ^u, between 
brahmä and ^suramanujoraga, which disturbs the sense, too, the 
editors failed to realize that this prayer of the distressed crew is a 
stanza in the metre aupacchandasika. It should be put in this form: 

&iva Varuna Kuber a &akra Brahman 1 
suramanujoragayaksamänavendräh \ 

vyasanam atibhayam vayam prapannäh 
vigatabhayä hi bhavantu no 'dya näthäh \\ 

Burnoüf LI. 256 has well translated this prayer. A similar 
stanza in the metre mälini is found in Avadänaöataka nr. 81 (f. 76 a 
of MS Cambr. Add. 1611). 

At p. 43, 22 another correction is necessary metri causa. It 

vUuddha§ilin suvisuddhabuddhe etc. 



As to -Min cp. Pän. 5, 2, 132. 

X. P. 51, 10. Cowell and Neil have rightly supplied the 
mutilated tradition by editing yady ekasyaiva pänlyam päsyärni, but 
in the sequel a small gap still remains to be filled. By adding one 
aksara the entire passage may be restored: yady ekasyaiva pänlyanj 
päsyämy (any)esäm bhavisyaty anyathätvam. Cp. Avadänasat. nr. 71 
(Cambr. Add. 1611, f. 66b 2) yady ekasmai däsyämi [sc. mama duhita- 
rani] anye me amiträ bhavisyanti. 

XI. On the same page 1. 23, an indispensable correction may 
be made with the aid of the transmissed text of the Avadänasataka. 
Tale nr. 36 of that collection, which is the prototype of Divy. nr. 38, 
as I propose to demonstrate elsewhere, contains the same sütra on 
filial piety as is found here, p. 51, 20 — 52, 3. But the Avadänas. 
mss. have not parikared as is edited here, with no meaning suitable 
to the context, but parihared. The whole sentence I think should be 
read thus: (yad) ekenämsena putro mätararjfi dvitlyena pitarar]i pürna- 



1 The origin of the superfluous aksara I suppose to be sought for in the 
frequent employment in our text of Sakrabrahmädyäh or -ädayah to denote all 
gods, e. g. p. 161, 27. 98, 6. 

E => 

(ü <D 
in 4-/ 
$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



110 J. S. Speyer. 

varsaSataTTi parihared yadvä etc. 'if a son were to carry about his 
mother on one Shoulder and his father on the other during a füll 
hundred of years\ — Similarly the Avad., where the formula sam- 
yaksambuddho loke utpanno — or udapädi — vidyäcaranasampannah 
sugato lokavid anuttarah purusadamyasärathih abounds, shows that 
p. 246, 6 after vidyäcarana the three syllables sampannah, have 
dropped. — And p. 619, 24 padako vaiyäkarano ought to be cor- 
rected according to Avad. nr. 74 (Cambr. Add. 1611, f. 69 a 11) tra- 
yänäm vedänäm päragah sanighanfakaitabhanäm säk§araprabhedänäm 
itihäsapancamänäni padako vaiyäkaranah. 

i-H 
^t 
fN 

IV (brähmanadärikävadänam). 

6 

XII. P. 70, 26. In the story of the brahman whose conversion 
Gautama Buddha brings about by telling him the parable of the tall 
nyagrodhatree sprung up from an insignificant seed, Gautama asks : 
kiyatpramänam tasya nyagrodhasya phalarti \ kiyat tävat \ kedära- 
mätram. The brahman cannot answer, as he does in the edited text, 
ko bho Gautama^ he says of course no bho Gautama = aXXa v&p °8. 
The fault recurs a few lines below (1. 28). The good reading has 

remained intact on p. 71, 18. 

3 * 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



VI (Indranämabrähmanävadäna). 

XIII. P. 76, 3 foll. — The brahman Indra after his conversion 
asks the Buddha his permission of arranging a certain festival in his 
honour: yadi Bhagavän anujänlyäd aharri gosirsacandanamayyä yastyä 
maham prajnapayeyam iti. The Buddha's answer has been vexed 
by copyists. In his words gaccha brähmanünujüätam prajfiapayasi, 
as is edited, the present of the indicative of the last word is wholly 
out of place. The Buddha says: f go, brahman, you are allowed; 
prepare (your festival)/ of which the Sanskrit original must ne eds 
be gaccha brähmanänujnätarjfi prajnapayeti. Cp. Buddhacarita 11, 
50, where I proposed a similar emendation (see Versl. en Meded. der 



F P. 



=) o 

— o 



Kon. Akademie van Wetenschappen } Afd. Letterkunde Derde Reeks, 

xi, 353). 

.E "ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Critical Remakes on the Text of the Divyavadana. 111 

XIV. On p. 78, 13 and p. 79, 23 two faults, the former dele- 
terious of sense, the latter of metre, ought to be corrected with the 
help of parallel passages. In fact, the story told p. 77, 23 — 80, 9 is 
repeated p. 466, 19 — 469, 18. By comparing both texts, it is clear 
that on p. 78, 13 must be read Bhagavatäsya tu, cp. 467, 10, and 
79, 23 °dharmacakra(pra)vartinäm, cp. 469, 7. 

VII (Nagarävalambikävadäna). 

XV. At p. 82, 12 the account of the merit bestowed by Ma- 
häkäfiyapa on a leprous beggaress whom he procured the opportunity 
of giving away in charity a small portion of foam of boiled rice, is 
introduced in this manner : sa tasyäh, sakäiam upasarrtkräntah \ tasyaS 
ca bhiksäyäm äyäsah sampannah \ tayäyusmän Mahäkä&yapo drstali 
käyapräsädikaS cittapräsädikaJi Sänteneryäpathena \ sä samlaksayati \ 
nünarri mayaivarrividhe daksinlye kärä na krtä yena me iyarp, evarri- 
rüpä samavasthä yady äryo MähäkäSyapo mamäntikäd anukampäm 
upädäyäcämani pratigrhniyäd aham asmai dadyäm iti. It is piain 
that äcämarp, here refers to some food mentioned before. Yet, no food 
has been spoken of in the foregoing. On the other hand, the word 
äyäsah (trouble, toil), though not wholly improper, cannot but serve 
to express the fruitlessness of her wandering for obtaining food; we 
should, however, rather expect äyäsa eva sampannah, not simply 
äyäsah sampannah. If I see well, the story- teller does not say it was 
äyäsa } but äcäma (foam of boiled rice) she obtained on her begging- 
tour. For this rcason, I think we have to correct: tasyää ca bhiksä- 
yäm äcämaJi sampannah. The aksaras ^jq and ^rTCT are ver y 
similar in Nepalese writing. 

XVI. P. 84, 15. — By two slight modifications the true form 
of this äloka, an exaltation of the Performance of meritorious acts, 



Q. 



cn 



<=> o 
c v> 

o E 

^-^ 4-1 

TD ±3 

> ^ 

£ ö. 

P 

U 

O <L> 

*s 

will be restored 

> cu 

C CT 

=) o 

— o 

c O 

kftapunyä hi modante asmin loke paratra ca. 

.c ^ 

ifl tn 

£ -o 

-ö v 

E-e 

E => 

fD O) 

$£ 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



karanlyäni punyäni dufykhä hy akrtapunyakäJi 
kftapunyä hi modante asmin loke paratra 

The edition has akftapunyatäh and krtapunyäni. 

Original fronn 






112 J. S. Speyer. 

VIII (Supriyävadäna). 

XVII. P. 100, 28. For dhanahärikah read °härakah. The 
meaning of Supriya's words is this: ,well, I will go on trade over 
sea in order to make money/ Now, it are thc krts in °aka which 
may be used with the signification of a participium futuri (cp. Pän. 
2, 3, 70); dhanahäraka = c rera paraturus'. The right reading is 
given by MSS in the parallel passage p. 332, 9. 

XVIII. P. 111, 20. — Either abhinivartante, the reading of 
MSS, should be retained, then we have to correct on p. 71, 6 
abhinivrttah for abhinirvjrttah, or the latter being all right, there 
must be written here abhinirvartante. It is wrong to prefer the one 
form here and the other there. Why should we suppose Sanskrit 
writing Buddhists to have used promiscuously the two different 
verbs ? In Brahmanical Sanskrit abhinivartate means 'to return 
home, to come back', as befits the Compound of nivartate f to return, 
to go back, to desist, to eease\ Again, it is nirvartate, not nivartate, 
that carries the meaning of 'developing, evolving, Coming into exi- 
stence\ Since, then, on both places quoted the meaning is implied 
that something arose, came into existence, it follows that the reading 
of MSS at p. 71, 6 is right, whereas at p. 111, 20 it must be changed 
into abhinirvartante. The inconsistency of MSS has nothing to do 
with our judgment about the matter. In the Avadänasataka, the 
subst. abhinirvytti is found in two tales — nr. 21 and 59 — in the 
formula of asking about the origin, the name and the 'later develop- 
ment* from man to Pratyekabuddha, respectively Devaputra. In tale 
21 it occurs three times, in tale 59 twice, and of these five occur- 

"E Q_ 

rences the good orthography occurs but once! 

This remark applies of course also to p. 111, 29 and 112, 13, 
where the text should be corrected {abhinirvartante for abhiniv.) 
and p. 227, 1 (read: abhinirvrttäni). 

XIX. P. 115, 25. — Taking into account that the redactors of 
the avadänas are wont to use a schematized phraseology and like 
to repeat the expression of the same facts with the seifsame words, 



■o 






O -ö 
^ fl) 



w I 

fN tO 

r\l ^ 

, 0> 

O u 



o o 

c v> 
o E 



(T3 



Cü 

_N 
'-I-J 

> <u 

c 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CRITICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 113 

it is not probable that the narrator of the story of Supriya, having to 
relate two times the awaking of his hero after a vision, should write 
once (p. 113, 17) suptaprabuddhah and another time (p. 115, 25) 
sukhapratibuddhah. I should rather consider sukha* to represent 
a misread supta . As to prabuddha and pratibuddha, it is diffi- 
cult to decide which of the two is to be preferred here, both 
being good Sanskrit. Cp. Kathäsaritsägara 3, 22 asya suptaprabud- 
dhasya. Buddhacarita 3, 14 suptaprabuddhäkulalocanäS ca. 

XX. P. 116, 2. In the kind address of the Kinnaragirls to the 
hero of the tale read: svägatarrt mahäsärthavähä(yä)smäkam asvämi- 
nlnäni sväml etc. Cp. the repetition of these words at p. 118, 1. — 
There are sundry cases of corruption of our text in consequence of 
aksaras omitted. Of the kind are the following instances. P. 121, 
10 in the narration of king Brahinadatta bestowing honour on bold 
Supriya, the dropping of the aksara sa disturbs the context, inducing 
the editors to a false interpunction. The true reading is this: Srutvä 
ca punar Brahmadattah KäHväja änanditafy (sa)pauravargah Supri- 
yam särthaväharri savfirädhayäm äsa. — P. 147, 10 in a similar 
manner yad is to be inserted, and the whole passage to be read as 
follows: tasya yävatl yänasya bhümis tävad yänena gatvä yänäd 
avatirya padbhyäm evärämarp, präviksat \ (yad)antarä räjä Mägadhah 
ßrenyo Bimbisäro Bhagavantam adräkslt tadantarä paüca kakudäny 

fD 

apanlya etc. — P. 204, 4. As the profound meditation, from which 
the Lord arose, is always called pratisamlayana, it is obvious that 
we ought to correct: athäyusmän Änandah säyähne (pra)tisamlayanäd 
vyutthäya. — At p. 177, 9 the reading of MSS sa nivartya vipra- 
lapitum ärabdhah cannot be understood and sins against grammar; 
I think, we have to correct sa nivartya(mäno) vipralapitum ärab- 
dhah r when he, the poor porte-malheur was thus being put outside, 
he began to weep aloud 3 . — P. 407, 4 read: ekäbhirämali praSamä- 
(bhi)räma$ ca sarjfivrttah. 



ö. 2> 



O -ö 
^ fl) 



w I 

fN tO 

r\l ^ 

, 0> 

° m 

i fD 

m - 

r-H 

o 5 

c v> 

o 2 



fD 

jc 

i 



U 

«4- ~° 

O <L> 

N 



03 ? 
> <U 

B ° 

The editors theraselves have often employed this means of re- 

storing the text. Compare e. g. p. 122, n. 1; 168 n. 1; 172 n. 6; 

199 n. 2; 318 n. 3. On p. 115 n. 3 the proposed trir ükotayati is 

o c 

E => 

fD <D 
10 4-J 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



114 J. S. Speyer. 

of course to be restituted here as well as in the other similar places 
(117, 4 and 13). 

IX (Men^hakag^hapativibhütiparicchedat). 

XXI. From p. 125, 24 to 126, 11 the solemn and splendid 
entrance of the Lord into the capital of the kingdom is described 
in stereotyped common-place terms, which recur at p. 148. Among 
many other comparisons extolling the splendour of the Buddha and 
his train, he is also compared to a guide surrounded by travellers. 
In both places the words expressing this are mutilated in MSS and 
in the edition. It should not be read deSika ivädhvaganaparivrtah, 
as edited p. 126, 2 and 148, 14, but deiika ivädhva{ga)ganaparivftalu 
The right reading is found in AvadänaSataka nr. 19, which con- 
tains the same common-place. 

XXII. At p. 126, 16 there can be no doubt that the word 
tirthyäh has been lost. By inserting it we do not but supply an 
indispensable element to the sentence: yadä Bhagavatä Srävastyäm 
mahäprätihäryam vidarHtam nirbhartsitä($ tlrthya) änanditä deva- 
manusyäh etc. Cp. p. 150, 5. 

XXIII. P. 128, 1. — The tirthyas teil the denizens of Bha- 
draipkara something like this: ,how is it that the monk Gautama, 
having made his your fields and goods, should not soon be about to 
make his yourselves?' This is expressed by the author of this tale 
as follows: bhavanto yo vas tävad acetanän bhävän anvävartayati sa 
yusmän nänvävartayisyatlti. The spaced words are my correction 
of the edited vo yas, which is not admissible because the enclitical 
pronoun cannot head the sentence. 






o -ö 
3 * 



w i 

fN tO 

f\l ^ 

° m 



c v> 
o E 



(T3 



X (Me^cjhakävadäna). 

. — What may be the 
here? It is asked how it came to be that Mepcjhaka, his wife, son, 



u 

«4- ~° 

O <L> 

XXIV. P. 131, 5. — What may be the meaning of abhijüäta 

> <u 

B ° 

daughter-in-law, man-servant and maid-servant became holy persons. 



Now, the standing phrase is jnato mahäpuiiyah, not abhijüato mahä- 
punyah, cp. p. 136, 6. 143, 6, and the beginnings of all avadänas in 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CrITICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 115 

Avad. In fact, abhi is corrupt. I correct: kirrt bhadanta Mendha- 

kena Mendhakapatnyä karma kftam yena sad api jfiätä 

mahäpunyäh samvrttä\i etc. ,what act has been done by M. etc., by 
the virtue of which all six became renowned holy persons?' Cp. 
Manu 1; 16 tesürp, tv avayavän süksmän sannäm apy amitaujasäm 
and my Sanskrit Syntax § 298. 

XXV. At p. 136, 15 evam eva cannot be right. I correct: yo 

"sau grhapatir esa eva Mendhako etc. Cp. 23, 21. 289, 11. 

313, 26. 

XI (Aöokavarnävadäna). 

XXVI. At p. 140, 20 paScirne has dropt before samucchraye, 
so that the whole passage is thus to be constituted: paScime bhave 
paicime nikete (paScime) samucchraye paScime ätmabhävapratilambhe. 
Cp. the parallel places 70, 3. 73, 16. Another instance of the Omis- 
sion of a whole word we had supra, nr. xxn. Likewise p. 142, 21 
Bhagavato is to be inserted before bhäsitam, p. 156, 16 Bhagavän 
before kälam (cp. ibid. 1. 26), and p. 371, 19 bhojanarp, before da- 
dhivyaüjanarri. P. 461, 10 Änandam is wanting in the mss. of our 
collection of tales, but it is found in its right place in MS 98 of the 
Biblioth&que Nationale, the nr. 13 of whose text coincides with nr. 
xxxi, first part (cp. p. 666 of the edition). 

O) 
u 
u 

.TD 



CÜ 



ti öl 



Q. 






(T3 



XII (Prätihäryasütra). 

XXVII. The six false teachers who provoke Gautama Buddha 
to a contention of miracles are called p. 143, 11 asarvajüäh sarvajna- 
mäninah 'not being omniscient, but thinking themselves so\ This true 
reading has been ridiculously corrupted twice (p. 145, 23 and 146, 
12) into sarvajnajnänino. The correction is evident. 

XXVIII. P. 154. — When prince Kala performs his satyopa- 
yäcana (== the saccakiriyä of the Päli books), he proclaims the su- 
periority of the Triratna with the so called three agraprajfiaptayas. 
These formulae, which are presented here in a Condensed form, are 
given in füll in Avadänasataka nrs. 9 and 57. A comparison of both 
texts shows that in two places the Divyävadäna must be corrected; 

1-E 
E =3 

ft3 <D 

to _c 
in 4-/ 



> <u 

C CT 

=> o 

rü 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



116 J. S. Speyer. 

p. 154, 21 vä between sarrijüino and näsar^ijninas is too much, and 
1. 24 for yugä we should read pügä. 

XXIX. P. 163. — The Lord has performed the miracle of the 
Buddhapinfa, showing to the astonished people the immense Cluster 
of Buddhas sitting within lotuses. Before taking back that splendid 
magic apparition, he advises his monks: *look well on this wonder, 
monks, it will on a sudden disappear/ tävat pratigfhntta bhiksavo 
"nupürve sthitäyä Buddhapindyä nimittam ekapade 'ntardhäsyanti. 
Here nimittam is a mistake for nirmitam. Both words are sometimes 
confounded in mss. ; their meaning is different. Nimitta has with 
Budtlhists the same acceptances as in non-Buddhistic Sanskrit; of 
those acceptances that which Stands here nearest to the matter of 
the context, viz. 'prognostic', is found e. g. Jätakamälä ed. Kern 
p. 64, 21. But it is not a prognostic, good or evil, that suits our 
case, but a miracle, and even this is meant with nirmita in Buddhi- 
stic Sanskrit, where nis -f- mä signifies c miraculous producing\ So 
nirmita, when adj., is = 'rnade by miracle, magic', as Divyäv. p. 162, 
10 nirmitam padmam, when put as a subst. neuter, it is f a miracle', 
nearly a synonym of prätihärya. In the first instance of a common- 
place on the smile of the Buddhas, there is said that the Lord sends 
off to the infernal beings a nirmitam darianam (p. 68, 6); in the re- 
petitions (p. 139, 13. 265, 25. 568, 18) it is only said nirmitarri vi- 
sarjayati without the addition of darsanam y and so always in the 
Avadänasataka, where that commonplace is often given in füll. It 
does, however, not appear what miraculous thing the Buddha sends 
to the infernal ones. Happily, in one of the Avadänamäläs I found 
a paraphrase of the expression, which contains sufficient Information 
to elucidate the question. In the Ratnävadänamälä nr. 12, which 
teils the same story as Avadänas. nr. 4, the närakäs, after perceiving 
the sudden rays of light penetrating into their infernal abode, are at 



■o 






■o 



O o 



(T3 



> 

- "r? 

F P- 



cu 



a loss how to account for that wonder; then 



C CT 
3 O 

Bhagavän nirmitam Buddharn praisayan narakän prati 
atha te närakält sarve drstvä tarn nirmitam munim 

^ tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 
O Q_ 



Original from 



CrITICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 117 

get faith in the Lord and begin to praise him (Paris MS of Ratnäv., 

f. 115 a 2). It is, therefore, his own likeness he makes come 

down to hell in order to save the hellish beings. Accordingly, in 

M. Feer's translation of the commonplace 'Rire et prediction du 

Buddha' in Annales du Mus. Guimet xvm, 11 instead of 'Bhagavat 

fait un signe' it should be said rather that Bhagavän sends off a 

miraculous likeness of himself. 

Another instance of nimitta put for nirmita is, I believe, at 
<* 

p. 547 in the story of Bimbisära wishing to return Rudräyana's pre- 
i^ 

sent by offering him an image of the Tathägata. Here nirmita pro- 

bably means 'likeness'; four times (547, 1. 9, 11, 14 and 16) nimit- 
tarn udgrahltum raust be changed into nirmitam udgr. 

XXX. P. 165, 17 the interrogative particle kaccid is hidden 
under the corrupted word katricit. That haccit occurs in Buddhistic 
writings, appears froin p. 421, 14. As the remainder of the question 
put to the harlot by the nirgranthäs, has been well preserved, no- 
thing impedes to write it down as an anus^ubh-sloka as it was in- 
■^ 

tended by its author: 

■= 8 

bhadre haccit tvam adräkslr gacchantam iha Püranam 

dharmasätapraticchannain katacchavratabhojanam. 

in ^ 

In the preceding stanza uttered by Pürana to the eunuch, the 
metre has been disturbed in consequence of a superfluous ca on 
1. 12. By Casting it away we get this mixture of tristubh and 
jagatl : 

na tvam naro näpi ca närikä tvam 

smasrüni te nästi na ca stanau tava \ 
bhinnasvaro 'si na ca cakraväkah 
evam bhavän vatahato nirucyate \\ 

«4- ~° 

o v 

As to vätahata, which expression was obscure to Burnouf (1. 1. p. 187 



'O) 



n.) as well as to the editors (see the Index p. 690), it may be per- 



3 * 



haps synonymous with väyugrasta and signify c mad\ Pürana seems 
to say that his interlocutor showing several marks of qualities con- 
trary to nature must of course be a madman, one possessed by 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original fronn 



118 J. S. Speyer. 

some evil spirit. The supposed naivety of the expression serves to 
enhance the author's scorn of the poor eunuch. 

XIII (Svägatävadäna). 

XXXI. P. 170, 29. — The merchant Bodha has died. Also 
his wife. Hiß wealth, hiß estate, hiß merchandises, slaves, cattle, all 
haß been lost, his relativeß do not care of hiß ßon Svägata, owing 
to the ill-fate of thiß young man, the result of ßinfiil actionß in a 
former exißtence. Even the old female slave who alone ßtayed with 
the unhappy child of her dead maßter, when all other servantß ran 
away, having realized that all that mißhap dependß on the ill-fate of 
young Svägata, leaveß the houße ßtealthily while the child is at 
school, taking with herßelf the few things of value which were still 
in the houße. The empty building is open, aß ßhe ran away without 
ßhutting the door; dogß enter and get into quarrel. Some rogue 
passing by and hearing the dogs barking within, underßtandß the 
house to be empty and goeß in. His consideration is expressed in 
a sentence, which has suffered in MSS. The edition has (p. 170, 28) 

c o 

sa sarplaksayati \ Bodhasya grhapater gfhe Svänah kalahani 

kurvanti kirrt tad anyam bhaveta paSyämi tävad iti. It is piain 
that anyarp is here wholly meaningless. The word required instead 
of it, is Sünyarri. The rogue concludes from the barking to the 
emptiness of the dwelling, and in fact the text continues: sa tatra 
pravisto yävat paiyati sünyam (p. 171, l). Bendali/s collation of the 
fragments of another MS (see Append. B of the edition, p. 660 foll.) 
has here, indeed, the variant mä haiva te Sünyam bhavena, where 
Sünyam represents, of course, the true reading; mä haiva etc. does 
not suit so well as kirri tac chünyarrt^ bhavena is a miswritten bhaveta. 
Nor do I believe the genuineness of the medial bhaveta. Since the 
viräma is not rarely put or omitted in mss. wrongly, this form is 
likely to be changed into bhavet. 

XXXII. At p. 171, 17 for prativiSanti need be restored pra- 
visanti, cp. 1. 23 pravisto, 1. 25 praviSäma, pravistäh. It is well 
known that ijf^ jffift and jj are often confounded in manuscripts. 



o -ö 
3 * 

^ (D 

m </» 

° ^i 

fN tO 
f\l ^ 
, O) 

O o 

c v> 
o E 

^-^ 4-1 

TD ±3 
> ^ 

£ ö. 

P 

ro ^ 
U 

O <L> 

*S 

öl 

T3 
CJ 
C CT 
=> O 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

fD O) 

10 4J 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



ti öi 



Critical Remarks on tue Text of the Divyavadana. 119 

In this manner p. 144, 20 sramano Gautamo riddhimän jfiänavädlty 

ätmänarri parijänlte must be corrected into pratijänite, for 

the meaning is: G. professes to possess miraculous power. Cp. p. 144, 
3. 145, 27. 146, 15. 

XXXIIL P. 172. — A merehant recognizes in Svägata going 
along the way as a beggar the son of his old friend Bodha, and ad- 
dressing him asks him respecting his nanae and his adventures. On 
which he is informed that his father and mother have died, his re- 
latives have abandoned him, his attendance have left him. Inquiring 
about the commercial agents and servants, he is told: ye banikpau- 
ruseyä grhitvä dhanärthino desäntaram mahäsamudram cävatlrnäs 
taträpi kesämcit panyam apanyibhütam kecit tatraivänayena vyasa- 
nam äpannäh etc. Between the second and third word of this period 
there is something wanting: it is said, some commercial agents set 
out on a journey to foreign countries and over sea to make money 
taking with them — what they took is not expressed. The object 
of grhitvä has been lost, it is easy to restore it, for it can scarcely 
have been another word but panyam. For this reason I supply: ye 
banikpauruseyäh (panyam) grhitvä etc. Cp. nr. xxvi. 

XXXIV. P. 173, 21 sa mätäpitwiyogapratispardhinä parva- 
karmäparädhaprabhävena duhkhadaurmanasyena samtäpitamanäh $ä- 
sravakanthas tüsnlm avasthitah. Two slight corrections need be 
made. Firstly, °prabhävena must be a misprint for °prabhavena 

H P 

(cp. my Observation supra p. 106). Svägata's sorrow because of every- 
body's disaffection towards himself equalled that caused to him by 
the loss of his father and mother and had its first origin (prabhava) 
in his Karma. Secondly, säsrakanthas is the true reading, not the 
unmeaning säsravakanthas. 

Some lines below (1. 27) ca should be inserted between anyais 
and catuspadaih, and p. 174, 3 the solecism bahih /Srävastyäm ought 
to be put, methinks, on the account of the copyists; the author wrote 
probably bahih brävastyäh. 

XXXV. The words spoken by the maid-servant to Svägata, 
(p. 175, 1 — 3) are in want of two small corrections in order to satisfy 

Wieuer Zeitsclir. f. d. Kunde d. Morgeul. XVI. Bd. 9 

o "E 
E => 

fO <D 

in +j 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Q. 



F P. 



u 

«4- "O 

O <L> 

CT 



=) O 

— o 



120 J. S. Speyer. 

the requisites of both grammar and sense. The corrections are in- 
dicated by spaced types: imäni te vasträni kärsäpanäs ca bhaginyä 
presitäni kathayati ca | yadi te bhägineyo vä bhägineyikä vä upa- 
sarpkrämati tasyaitän karsäpänän dadyä mä jnätlnäni pratarkyo 
bhavisya(8i)ti. 

XXXVI. P. 177, 4. — The beggars ascribing their ill-chance 
at Anäthapigd&da's to the presence of Svägata ask one another: pa- 
syata mäträryä Durägata ägato bhaved iti. Here the voc. äryäh — 
for by what eise may ^TTRTT be explained but by resolving it into 

o 

mä atra äryä? — is as improper in the mouth of those beggars as 
in the connexion of the sentence, so inuch the more as the voc. bha- 
vantaJ} immediately precedes. I suppose, TTTRn is a corruption of 
TTTTCn, cp. the parallel place 173, 9 mäsau Dur ägato 'trägatah syät. 

XXXVII. P. 179. 9 the editors were wrong changing putro- 
yam (MSS) in ptttremarji. The true reading, methinks, is this: pu- 
träyarri pätraJesah paribhuitksveti 'my son, take here that remainder 
of the bowl ; enjoy it'. Cp. sub n. 

XXXVIII. P. 191, 3. — The words of the precept, whereby 
Bhagavän forbids his monks to drink or cause to drink strong liquors, 

|— to 

are vitiated by an absurd form uddiiyadbhir, which is at the same 
time devoid of meaning. I propose this mode of restoration: mäm 
bho bhiksavafy sästäram uddiiya (bhava)dbhii* madyam apeyam 
adeyam antatafy kuSägrenäpi. Cp. sub xx. 



w i 

fN tO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



2 5 



F P. 



XVI (sukapotakävadäna). 

I do not understand what reason moved the editors to keep 
intact at p. 198, 14 and 23 bhadantah, though it is obviously a cler- 
ical mistake for bhavantah, whereas they have corrected this usual 
blunder of MSS on other places (e. g. p. 186, 16). 

«4- ~° 

O <L> 

XVII (Mandhatävadäna). 

> 0) 
C CT 
=) O 

— o 

c O 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

to _c 

tO X-> 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



XXXIX. The frame-narration of this avadäna Covers the same 
ground as Mahäparinibbänasutta m = Udäna vi, 1. Windisch, who 
in his Mära und Buddha p. 43 toll, compared the Päli and the San- 



Original from 



CRITICAL KrMAKKS OM THE TEXT OF THK DlVYAVADANA. 12 i 

skrit texts, as far as they raay be considered almost identical, by 
printing them in a synoptical manner opposite, has in several places 
corrected the edited text of Divyävadäna. This juxtaposition is also 
of use to restore the following passage. 

Mära, the Evil One, approaches the Lord when alone and 
reminds him of his irarainent nirväna. Buddha answers: c why do 
you speak so?' The Evil one replies: 'It is the proper time. When 
staying at Uruvilvä, being urged to go into nirväna, you told nie afiter 
fulfilling which conditions your time of becoming extinguished would 
come; now those conditions have been fulfilled; for this reason, I 
say, now is the proper time of your supreme nirväna'. In the be- 
ginning of this reply of Mära, p. 202, 6 the printed text has: eko 
'yarn bhadanta samayah | Bhagavän Uruvilväyäm viharati etc. What 
can be at all the meaning of eka in that connexion? The word re- 
quired is itkto, not eko. ,Yourself, says Mära, have fixed that time/ 
In the Nepalese writing the aksaras e und u are sometimes difficult 
to be distinguished. Now, that the correction is good, is put into 
evidence by showing the correspondent place of the Päli text (Win- 
disch 1. 1. p. 46): bhäsitä kho panesö. bhanta Bhagavata väcä, where 
bhäsitä quite answers to ukto of the Sanskrit text. 

XL. P. 205, 21. — As the Wheel of Law has three revolu- 
tions (parivartäs) and twelve spokes (aräs), it is proper to read 
triparivartadvädasäram instead of dvädasäkäram. A similar mistake 
as has been here made by copyists, is putting °prabhäva for °pra- 
bhä, e. g. Avadänai. nr. 3 (p. 17, 9 of my forthcoming edition). 

XLI. At p. 210, 18 I read prasnutäh for prasrutäh, as the 
breasts of the sixty thousand royal wives were filled with overflow- 
ing milk at the birth of Mändhätr; the reading prasrutäh would 
import that they melted away. It is the root snu — not sm — 



ti öi 



Cl 



03 






F P. 



> <u 

c 

o 



which denotes the dripping of Organs secreting fluid, especially the 
milk out of a female breast; cp. the Petropolitan Dict. s. v. snu 

o 

and snu + pra. Parallel places are Mahäbh. ed. Bombay 3. 22<>, 

24, where the Mothers invite young Skanda to take their breasts: 

9* 

'-o v 

E-e 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



122 J. S. Speyer. 

abhinandasva nah sarväh prasnutäh snehaviklaväh \ 
täsärri tad vacanam Srutvä pätukämali stanän prabhuh, 

Vikramorvaäi act V, stanza 12: 

iyam te janarii präptä tvadälokanatatparä 
snehaprasnavanirbhinnam 1 udvahantl stanämfotkam, 

and Dasakumäracarita (ed. Täränätha p. 112, 10) sä tu vrddhä 

parisvajya muhuh Hrasy upäghräya prasnutastani sagadga- 

dam agadat. 

In the following sentence read: ekaikä kathayati. 

XLII. P. 214, 9. — The likeness of the aksaras $ca and &va 
has caused the word svayam to be put by copyists in a sentence, 

6 

where it did not belong. The genuine reading, however, may be 
easily restored. Divaukasa speaks: asti deva Pürvavideho näma dmpa 

rddhaS ca äklrnabahujanamanusyaS ca | yan nu devo gatvä 

tarn apy äjnäpayet. Parallel places in the sequel (p. 214, 26. 215, 
6. 215, 14 — 21) prove the rightness of this correction. 

XLIII. P. 226, 20 runs thus in MSS: tatra visaye dharmatä 

c o 

yä acirodhä därikä bhartari pravahanakena pratipädlyati sä catüra- 
tnamayaih puspair avaktrya baddhakä svämine pradlyate f in that coun- 
try it is custom that when the young-married maiden is delivered to her 
husband in a carriage, she has put on flowers made of four kinds of 
jewels, she has been scattered with\ The form pratipädlyati offends 
by its barbarous aspect, therefore the editors changed it into prati- 
pradlyate. But, as pradlyate is the predicate of the apodosis, it is 
more likely that the fault ought to be corrected otherwise. If the 
author of this avadäna wrote always a pure Sanskrit, pratipädyate 
would doubtlessly be the genuine form, which would have been cor- 
rupted in mss.; now we may doubt between pratipädyate and some 
barbarous form as pratipädlyate or even pratipädlyati itself may be 
left intact, inasmuch as it represents a Päli passive patipädlyati. 

C "CT 

=) O 

— O 

c o 

1 My hand-edition, that of Jivänanda Vidyäsägara (Calcutta, 1873) has: &ne~ 
haprasrava — .. 

£ -o 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Cl 



CT 






(T3 



2 5 



F P. 



u 

O <L> 
CT 



CRITICAL ReMAUKS ON THE TeXT OF THE DiVYAVADANA. 123 

XVIII (Dharmarucyavadäna). 

XLIV. P. 23 1 ? 1. — When thc giant fish timingila — who in 
parenthesi is named timitimifigila on p. 234, 5 1 — goes after food, 
he is wont to rise upward from the third and lowest stage of the sea 
to the first and uppermost one. This is apparently meant by the 
words tatra timingilo näma etc. (p. 230 7 30 — 231 ? 2). But how to 
analyze the complex abhyitdgamyoparimandakaskandham,? As the 
author of this avadäna m\ 18 writes a tolerably bad Sanskrit, wc 
may not be very far from truth, methinks, by supposing he wrote 
abhyudgamyoparimam dakaskandham, using daka instead of udaka. 
With uparima cp. 2, 23 uparimäm bhümim, p. 99, 15 adharima and 
Päli pürima. 

On 1. 10 of the sanie page it is likely the aksara säm is wanting 

after te. The context requires: te(säni) vahanam dr.stvä 

samvega utpannah. 

XLV. At p. 234, 3 I read: yäni täni panca bhikmsatäny atlte 

dhvany etäny eva täni panca bhiksusatäni f the selfsanic 500 

bhiksus, who took the Orders in the days of Käsyapa, are these 
very 500\ The reading of MSS etävanty etäni is improper, the exact 
number added precluding the addition of a word meaning: f as many.' 
It must be expressed that they are the sanie individuals, not the 









w I 

fN CO 

f\l ^ 

, O) 

-* U 

same number 

O o 

c v> 
o 2 



(T3 



XLVI. Ibid. 1. 16 — 18 two slight errors are to be removed. 
Read : asyäm ca Srävastyäm [the second ca is superfluous] fasya 
brähmanasya yadä patnl antarvartint samvrttä tadaiva etc. Thc 
adj. antarvartint affords another example of erroneous sanskritiza- 
tion. The right and old word denoting 'a woraan with child' is an- 
tärvatnl = äpannasattvä (see Petr. Dict. s. v., for another instance cp. 
Dasakumärac. ed. Täränäthatarkaväcaspati p. 143, 12). In vulgär 
dialects parasitical i having introduced itself between t and n 7 an- 



> <u 

=) o 

— o 



03 



fD 



1 I change, therefore, Units Umiügilo into UmiUminr/ilo. In Nepalese mss. st 



and t are not seldom put one for another, 

.E -o 



'■o £ 

E-e 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



124 J. S. Speyer. 

iah -f- vatnl becarne antova(t)tini, out of which the Buddhists san- 
seritizers shaped their antarvarttinl. 

XLVII. Ibid. 1. 25. — As abhyavahy = 'to enjoy food', not 
avahr, the aksara bhya must have dropped. Restoring it, we get: 
sä tarn apy a(bhyd)vahftya naiva trptim gacchati. Cp. 1. 21 abhyava- 
harasva and abhyavahartum, 1. 22 abhyavahrtya. 

XLVIIL P. 235,11. —The doctors declare that the brahman's 
pregnant wife does not suffer from any illness nor froin being pos- 
sessed by any bhüta or graha: näsyäh kaScid anyas tadrüpo rogo 
näpi bhütagrahäveSo badhäkära utpannah. So the edited text. Now, 
as bhütagrahäveia means 'possession by some demon', its appositional 
connection with badhäkära 'a species of illness' disturbs the natural 
course of the utterance. By a slight change, making ä out of o, we 
get: näpi bhütagrahäveiäbädhäkära utpannah f some species of af- 
fliction in consequence of possession by some demon\ This correct- 
ion is favoured by the consideration that in the Avadäna - texts it 
is äbädha 7 and not bädha, that is the proper word to denote *af- 
fliction and pain\ 

That p. 235, 19 the right reading is °svajanayuvatyas, follows 
by comparing p. 234, 24. — P. 236, 6 mss. have a superfluous anu- 
svära; read: paryatitvähärakrtyam kuru. 

XLIX. P. 242, 27. — A set, who is a devotee of the Buddha 
Kscniankara, on returning from a journey hears of the parinirväna 
of his master and his foremost youngers. He is utterly grieved by 
that sad news and swoons sammürchitas ca bhümau patitdh,. But in 
what follows the corruption of the text checks the understanding. 
Impossible to draw a satisfying meaning from this sentence: tasmäc 
ca jaläbhisekena pratyägatapräno jlvita utthäya bhüyah prcchati. I 
correct: paicäc ca jaläbhisekena pratyägatapränajivita 'afterwards 
having recovered his senses by sprinkling with water . The author 



.c o 






w i 

fN tO 

f\l ^ 

O u 



O o 

c ^ 
o E 



F p. 



CT 



of this avadäna delights in the use of pakcät for tatah to continue 
the thread of his tale; see p. 232, 20. 233, 12. 235, 18 and 21. 236, 
28. 239, 25 and 28. 249, 12 and 23. 251, 29. 258, 20 and 25. 261, 



03 



fU 



15; 16; 19. 

.E "o 

T3 £ 

E-e 

E => 

fD O) 

10 X-> 

$£ 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



0} 






^ fi) 



w I 



f 10 - 

O o 

c w 

o 5 



(T3 



> I 
cc: 

F P. 



u 

«4- "ö 

- 0) 



CRITICAL ReMAKKS ON THE TeXT OF THE DlVYAVADANA. 125 

L. P. 241), 4. — Sincc thc garland-maker objects to bringing 
the seven lotuses into the town, because he is afraid of the king, 
he cannot say Jcatham etäni pravesakäni bhavisyanty asamviditam 
räjahalasya, but praveSitäni. 

LI. P. 252, 2. — Suinati, in order to gather mcrit by an act 
of piety towards the Buddha Dlpaipkara, lays himself down on the 
dirty soil, in order that the Buddha treading on his tresses may 
avoid the mud; and while doing this, he utters a pranidhäna. From 
tlie very words of the gäthä and from the description of Dlpaipkara 
putting his feet on the tresses to comply to his request, there can 
exist no doubt as to the arguinent of the passage. For this reason, 
the words jatä samtlrya cannot be right ; they are corrupted out of 
jafäh samstlrya. Cp. supra ? p. 123, n. 1. 

LH. At p. 252, 11 I propose a differcnt rcstoration of the mu- 
tilated first part of the sloka, by which Dipaiukara prediets the 
future Buddhahood of Sumati. I read it thus: 

bhavisyasi tvam nrbhavädhimukto (yukto) vibhur lokahitiiya sastä 
bäkyätmajah tSäkyamitniti näma etc. 



The epithet nrbhavädhwmkta expresses the requisite in a person, 
who is eager for attaining Buddhahood, namely his attachment to 
human existence which he prefers to reaching nirväna without be- 
coming a Buddha. 

Uli. At p. 254, 3 begins the story of the young man who 
ceding to the wicked inclinations of his mother, became a husband 
to her, and turned out in the end a patrieide, a matrieide and an 
arhat-killer. The text is here in several places extremely corrupt. I 
venture to restore a few out of this number: 

1. P. 254, 6 there must be a gap of some words after Bhaga- 
vän, which must have contained the mention of Krakucchanda's 
dwelling at SobhävatI; cp. Avadänas. nr. 50 and 75 in Feer's trans- 
lation Ann. du Musee Guim. xvm, p. 193 and 283. 



> <u 

C CT 

=) o 

— o 

CO 

2. In the passage p. 254, 12, where the lnerchant declares his 
purpose to go on trade over sea, I correct: gacchämy aham idämm 

£ "o 
-o v 

E-e 

E => 

to _c 
in 4-/ 

s_ C 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 






126 J. S. Sfeyer. 

bhadre banigdharmena 1 | sa ca banig lobhenävrto du- 

ratarani gato etc. 

3. P. 256, 7. — The laseivious woman has obtained at last a 
rendez-vous with her son ; who does not know it is his own mother 
who will come to him to make love. Now, tasya därakasya tasmin 
gyhe gatasya ratikrtdäkälam ägamayamänasya tisthato ("while the 
young man was staying in the [appointed] house in expeetation of 
the sexual pleasure to come") niii kälam apratyabhijnätam \ rüpe 
käle sä mätäsya banigdärakasya tasminn eva grhe ratikridäm anu- 
bhavanärtham tatraiva gatä. So the edited text. It is piain that the 
beginning of the main sentence defies every hermeneutical art; from 
the words sä mätä the text becomes piain again ; f the mother came to 
the same place that she might enjoy sexual pleasure in that very 
house\ By the note on p. 707 the editors show they are aware of 
the corrupt State of the first part of the sentence, but their query 
whether the mother came in a black dress, as he could not notice 
black in the darkness, does not help a bit to construe the meaning- 
less complex nisi kälam apratyabhijnätam rüpe käle. I propose to 
correct: nisi (vi)käle apratyabhijnätarüpe käle sä mätä etc. 'at 
night, untimely, at the time when the shape of the objeets cannot 
be recognized, his mother came'. 

4. P. 256, 21 yathä ihaiva grhe ratikrldä bhavema, unmean- 
ing. Two aksaras have dropped between °kridä and bhavema. Insert- 
ing them, we recover the hand of the author yathä ihaiva grhe ratikri- 
dä(m anujbhavema, cp. 1. 8, 10, 16 and 19 where the same phrase 
oecurs. 

5. P. 258, 5. — Either by some error of print or owing to the 
inadvertency of copyists the inverse is expressed of the author's mean- 
ing. The sentence must of course be: kämän khalu pratisevato na 
hi kimeit päpakam karmäkaranlyam iti vadämi, the printed text 
has: karma karanlyam. The same adage is found in Avadänas. nr. 33 
with the variant pratisevamänasya nästi kinicit. 

c O 

1 Cp. p. 259, 27 with the note of the editors. Similarly p. 258, 23 käladhar- 
manä cannot be anything eise but a miswritten käladharmena. 

-ö v 

E-e 

E =3 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



TD 

Cl 



cn 






(T3 



2 5 



F P. 



u 

O <L> 

CT 






Q. 



.TU 



CRITICAL ReMARKS ON THE TEXT OF THE DlVYAVADANA. 127 



XIX (Jyotiskävadäna). 



LIV. P. 263 ; 13. — The sramana Gautama has predicted to 
the householder Subhadra the future greatness of his son to be born. 
Now, Subhadra being an adherent of the Nirgranthas, teils Bhürika, 
a monk of that order, to control that Statement of the Buddha. Bhü- 
rika, who was a skilled astrologer (ganitre krtävi), soon discovers 
the exactness of the prediction, but he fears that by telling the 
truth he may perhaps cause the reputation of his adversary to in- 
crease and augment Subhadra's inclination for Gautama. If I approve 
of the prediction entirely, so he thinks, that householder will be at- 
tached the more to that äramana Gautama; for this reason he resolves 
to beat down a great deal of the prediction. In that part of the text, 
which contains the deliberation of Bhürika, there is one corrupt 
word: yady anusamvarnayisyämy ayam grhapatir bhüyasyä mätrayä 
iramanasya Gautamasyäbhiprasamsyati. So MSS. The editors, con- 
sidering the impossibility of holding abhiprasarnsyati for a real word 
written by the author of this avadäna, have put into the text, with 
transposition of the sibilants, °bhipra6amsyati. Yet, what can be at 
all the meaning of this Compound of sarris, which is moreover a bar- 
barism. Further, it is not a present tense, which is here required, 
but a future. In short, the word wanted is abhiprasatsyaii, the 
future of abhipraszdati. 

LV. P. 270, 7. — When the child whose future greatness Gau- 
tama had predicted appeared on the lotus Sprung from the womb of 
his mother's burning corpse, the Nirgranthas could not conceal their 
astonishment and confusion. This must be the content of the follow- 
ing sentence, transmissed in MSS and edited in this shape: Nir- 
granthä nipätamadamänä na ca prabhäväh samvrttäh. This is mere 
nonsense. The true meaning of these words reappears, if they are 
restored in this manner: Nirgranthä viyätamadamänä hataprabhä- 
väh samvrttäh. I should not wonder, if in the MS now in the pos- 
session of Parujit Indränand of Patan this very reading were to be 
found, the aksaras va and na, ya and pa } ca and ta being often 



<=> o 
c v> 

o E 

^-^ 4-1 

TD ±3 
fD 

jc 

i 

- "> 

P 

U 

«4- "O 

O <L> 

N 
'-I-J 

'a 
> 

c 

fD 
5 CD 

ifl tn 

£ -o 
-o v 

E-e 

E => 

(ü <D 

to _c 
in 4-/ 

$£ 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



128 J. S. Speyer. 

eonfounded. Of course, viyäta- is hcre used like the more frequent 
participles apagata-, vigata-, wta-, 

Similarly on p. 377, 12 vyäyatamatih ought to be corrected into 
vyäpannamatih. The monk was 'afflicted of mind*, thinking of death 
awaiting himself after seven days. 

LVI. Dealing with the corrupt place p. 270, 29 niyatam te 
gyham utsädar[i bhavisyasi tvani ca pränair viyujyasa iti, the edi- 
tors deemed the word utsädani to want correction and put instead 
of it utsädayan. Yet, the Opposition between the two members of 
the sentence precludes such a Solution of the difficulty, as gives one 
subject to both, and the expression utsädayan bhavisyasi looks 
rather uncommon. In my opinion utsädarp. is quite right, it is bha- 
visyasi that should be emended. I propose: niyatai\i te grham utsä- 
dat\i gamisyati r your house will certainly be uprooted\ As to utsäda 
as a nomen actionis of utsldati = 'perire', cp. Petr. Dict. v, 1167. 

LVII. P. 271, 6. For bhavati read bhavatu. The imperative is 
regulär in this standing formula. 

LVIII. P. 272, 16 and 21. On both places the participle upa- 
kränta = %pa7:£'j6£{;, curatus* has been spoiled in the tradition of 
the MSS. As it is piain from the context that even this is wanted, 
tathäpakräntä ought to be changed into tathopakräntä. Cp* su- 



ö. 2> 
ti öi 

.C o 






w I 

pra, nr. n. 

° m 



LIX. P. 278, 22. Correct: sa vismitya kathayati. It is not said 
that Jyotiska forgot anything, but on seeing his fine and wonderful 



o E 



bathing-garment in the hands of Ajätasatru, he is astonished. 

LX. At p. 280, 29 sankitam, as is edited, cannot be right. It 
is not his boldness but his want of power, of which Ajätasatru 
complains. The right reading, methinks, is: Ajäta6atrufy samlak§a- 
yate | evam api mayä na Sakitam Jyotiskasya manln apahxtrtuvi 



(T3 



% 5 



O <L> 



anyad upäyani karomi. Cp. my Sanskrit Syntax, § 387 R. 



> <u 

C CT 

=) O 

— o 



XXI (Sahasodgatasya prakaranavadäna). 

LXI. P. 299, 11 and 300, 2. In the passage which celebrates 
Maudgalyäyana's preaching in the beginning of this avadäna, the 

.E ~o 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 






CrITICAL REMARKS ON THE TEXT OF THE DlVYAV ADANA. 129 

veirb ava -f- vad expresses the idea of 'preaching to, edifying, ad- 
monishing. With the present avavadati (299, 10. 300, l) and the 
future avavadisyati (299, 27) no other participle in -ta is gramma- 
tically allowed but avodita = ava -\- udita. For this reason the 
doubt expressed by the editors as to the reading of MSS in n. 1 on 
p. 300 has no ground, and on p. 299, 11 the good form avoditäk 
ought to be put into the text. 

The gerund avodya has been corruptcd p. 498, 12. p. 504, 12 
and 14; the first time MSS have parlttenävavädena codya, the second 
timo parlttenävavädenäcodya, the third time parlttenävavädenävädya 
(cod. A -cädya). The author wrote, of course, in all the three in- 
stances : °ävaväden avodya. 

LXIL What may be, p. 302, 26, the meaning of nayena kä- 
mangamah? The word is coordinated with words expressive of bond- 
age and dependency: däsah presyo nirdeSyo bhujisyah, in connexion 
with the glorification among the advantages of inonkhood of this 
point that one becomes a person venerable and deserving honour 
from the side of even those, to whom one has been subjeeted in the 
world. By dividing the transmissed aksaras nayenakämangama/t other- 
wise we recover the meaning of the author, who meant na yenakä- 
mamgamah 'not allowed to go where one likes\ 

LXIIL If, says the interpreter of the painted pancagandaka 
cakra, the homeless life of the bhiksu does not result to bringing 
about nirväna, then at all events rebirth among the Devas is assured. 
This being the argument of the period which begins p. 303, 2 anut- 
tarant vä } there can exist scarcely any doubt that the syllable an 
is wanting on 1. 3 at the place, where I insert it. The whole period 
should run as follows: anuttarani vä yogaksemaijft nirvänam (an)anu- 
präpnuvato 'näpattikasya sato devesüpapattir bhavisyatiti sampaiyatä 
panditenälam eva pravrajyädhimuktena bhavitum. In the archetype 
of our tradition, the fifth aksara of the complex f^fipprjJrrapRft 
has been omitted by an oversight of the copyist. 

LXIV. On p. 305 the verb vyai\isayati 'to deeeive' oecurs 
twice, viz. the partic. vyanisitah (1. 13) and the fut. vyamsayisyasi 
E-e 

E =3 

ro <V 

in _c 
in 4-/ 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

O Q_ 






(T3 



2 5 



F P. 






z> 






130 J. S. Speyer. Critical Remarks, etc. 

(1. 14). A third instance is found in the Pancatantra (p. 253, 1 of 
Jivänanda's edition), ep. Petr. Dict. s. v. vi, 1427. The nomen actionis 
vyartisana is found once in Mhbh., see Pet. Wörterb. in kürz. Fass. 
vi, 173, the nomen agentis vyavisaka as second member of certain 
Compounds Pän. 2, 1, 72. There is no doubt concerning the mean- 
ing of the word, but its origin is concealed by a false orthography. 
The original signification must have been 'to oust anybody of his 
portion': vyamSayati, a denominative of vyanisa = vi + aniSa (por- 
tion). This original meaning suits well this passage of Divyävadäna. 

LXV. By a wrong conglutination of words that ought to be 
severed the utterance of the householder at p. 312, 15 is scarcely 
intelligible. I divide thus: tvam pindakenärthl aham api punyenä- 
sminn evodyäne vihara pindakenävighätam karomi r you are in 
want of food, I of merit; take your abode in this very garden, I 
will supply you with food\ — Similarly p. 313, 15 foll. must be di- 
vided thus: sa mülanikrtta iva drumah saputrah pädayor nipatitah 
avatarävatara sadbhüta daksinlya. 

LXVI. P. 313, 7 adräksit sa Pratyekabuddhas tarn grhapatim 
ätmanä dvitiyam ägacchantam \ sa sanilaksayati \ na kadäcid ayavi 
grhapatir ätmanä dvitiyam ägacchati. Correct: dvitlya ägacchati. 
The adjective, not the adverb, is here required by syntax. The 
aksaras T and ^IT are sometimes confounded in Nepalese mss., cp. 
the editors' n. 4 on p. 318. 

(To be cuiitiuucil.) 



T3 



Ö. ^ 
V öl 






w i 

fN tO 

f\l ^ 

O u 



o o 

c v> 
o E 



- "r? 

£ ö. 

P 

U 
O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

10 4J 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



Einige arabische Ausrufe und Formeln. 

Von 

Ignaz Goldziher. 



Das Kitäb al-agäni enthält mehrere Erzählungen, die zum Er- 
weis der Erfahrung dienen sollen, dass man im 2. Jahrhundert des 
Islam über die Zulässigkeit der Musik im 'Irak viel strenger urtheilte 
als im (Ji£äz, der Wiege des Islam. 1 In Mekka hat der fromme 
Gottesgelehrte f Ata b. abi Rabäh (st. 114) gegen ein in seiner Gegen- 
wart veranstaltetes Concert nichts einzuwenden; er hört es bis zu 
Ende mit grossem Interesse an. 2 Auch im frommen Medina kann 
sich viel freier ein munteres gesellschaftliches Leben entfalten 3 als 
im 'Irak, dieser Heimath der in die Auffassung des religiösen Lebens 
eingedrungenen theologischen Spitzfindigkeit. 4 Hier werden wohl 
JJaclit-Sprüche entstanden sein, die den Fluch Gottes auf die Sänger 
und ihre Zuhörer herabrufen. 5 Die higäzenische Religionsauffassung 



CÜ 



t! öi 



O -ö 



w l 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P- 



§ S 

2 1 

1 Vgl. die Nachweise in den Mukammedanischen Studien u, 79, Anm. 

2 Ag. i, 109, 18 ff. 

3 Wellhausen, Die religiös-politischen Oppositionsparteien im alten Islam, 95, 

«4- ~° O 

8 v. u. 

> 3 

4 Siehe die vergleichende Schilderung, die Ibn abi-1-zawä'id (Zeit des Cha- 

lifen al-Mahdi) von den beiderseitigen Verhältnissen entwirft, Ag. xn, 172, unten. 

5 <*J ÜiJ\^ ^JUl^X <Jdl)l ^^a); als unecht gekennzeichnet in der von 
Sujüti bearbeiteten kleinen Hadit-Sammlung des Badr al-din al-Zarkasi, unter dem 
Titel tj^XJuJX CUjoIsOM ^ *jSLZJ^J\ jj^\ (Kairo, Mejmenijja, 1307) a. R. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



132 Ignaz Goldziher. 

war nicht so musikfeindlich; und auch das strenge 'Irak mildert 
seine theoretische Opposition immer mehr, als die musikalischen Unter- 
haltungen an den Höfen der Beherrscher der Rechtgläubigen ein- 
heimisch wurden, in deren Schutze Sänger und Sängerinnen das 
munterste Leben führen konnten. Da rühmt der Chalife al-Watik, 
selbst ausübender Künstler, die Musik als eine ,Kenntniss, welche 
von den Alten gepriesen ward, nach welcher die Genossen des Pro- 
pheten und ihre Nachfolger verlangten, und welche im Heiligthum 
^r 

Allahs (Mekka) und dem Auswanderungsort des Propheten 

sehr viel geübt wurde'. 1 

Unter den Agäni -Erzählungen, die noch jenen Gegensatz der 
alteren Zeit veranschaulichen, ist keine mehr charakteristisch, als 
eine in die Biographie der Sängerin Gramila eingeflochtene Episode. 2 

Die Sängerin veranstaltete einmal in ihrem Hause eine Zu- 
sammenkunft, zu der sie jedem, der nur zugelassen werden wollte, 
freien Eintritt gewährte. Ihre Halle war von Menschen dicht erfüllt, 
die sie durch ihre Sclavinnen reichlich bewirthen Hess. Als alle 
Gäste bereits frohen Muthes waren, richtete Gamila folgende An- 
sprache an die Versammlung: ,Ich hatte einen schrecklichen Traum, 
der mir fortwährend Angst einflösst. Ich kenne die Ursache nicht, 
fürchte aber, dass er das Herannahen meines Lebensendes bedeutet. 
Ich muss nun daran denken, gute Werke zu üben, die mir nützen 
könnten. So habe ich mich denn entschlossen, das Singen aufzu- 
geben, aus Besorgniss darüber, dass mir dies vor meinem Gotte von 
Nachtheil sein könnte/ Viele billigten den frommen Entschluss; an- 
dere glaubten, dass Gamila unnütz Scrupel hege. Da erhob sich 
ein ehrwürdiger, gelehrter und erfahrener Scheich aus der Versamm- 
lung und richtete folgende Ansprache an sie: , Jeder der Versam- 



Q. 



w i 

fN CO 

O u 






o E 



F p. 



u 

«4- ~° 

o aj 

der Fatäwf haditijja des Ibn Hagar, 197. Auch unter den Fikhschulen ist es die 

'irakische (Abu Hanifa), welche die Musik als verpönt (makrüh) oder als geradezu 

verboten (haräm) erklärt. Vgl. über diesen Gegenstand Hasan b. 'Abdallah, Atär 

al-uwal fi tartib al-duwal, 140 (a. R. von Sujiiti, Tärieh al-chulafa, Kairo 1305). 

1 Ag. viii, 1C>2, 5 v. u. 

2 Ag. vn, 142—143. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Einige arabische Ausrufe und Formeln. 133 

melten hat seine Meinung ausgesprochen, und jede Partei hat Wol- 
gefallen an ihrer Ansicht. Ich will niemand in seiner Ueberzeugung 
stören, wenn ich auch dieselbe nicht theilen kann. Aber man möge 
nun auch meine Rede ruhig anhören und mich nicht unterbrechen, 
ehe ich geendet. Wer meine Meinung annimmt, dem hat Gott Ein- 
sicht gegeben, wer anderer Meinung ist — auch dem nehme ich es 
nicht übel, da ich das Bewusstsein habe, selbst im Gehorsam Gottes 
zu stehen/ Da trat nun lautlose Stille ein und der Scheich begann 
eine wohlgesetzte Rede, die mit dem Lob Gottes und dem Preis des 
Propheten anhob. Daraufsagte er: ,0 hi£äzenische Leute! Seitdem 
ihr die Macht verloren, seid ihr kraftlos geworden und euer Feind 
hat euch überfallen und überwältigt und niemals werdet ihr wieder 
Oberhand gewinnen. Ihr habt euch einschüchtern lassen von den 
Leuten vom 'Irak und anderen Leuten, die nicht aufhören zu miss- 
billigen, was ihr als theueres Erbstück besitzet, was weder euere 
Gelehrten schlecht finden, noch euere Frommen zurückweisen, wie 
dies gross und niedrig bezeugen kann . . . Wenn sich der Fromme 
davon zurückzieht, thut er dies nicht, weil es etwa verboten wäre, 
sondern aus asketischer Neigung, da ja der Gesang der höchste Ge- 
nuss und die grösste Freude ist. Er belebt das Herz, mehrt den 
Verstand, erfreut die Seele etc/ Nun folgt eine Verherrlichung der 
Musik. ,Wie könnte man nun das Unterlassen derselben für richtig 
halten und sich nicht dieses Mittels bedienen, um sich für den Dienst 
Gottes zu erfrischen' — so endete der Scheich seine Rede. Niemand 






o E 



(T3 



widersprach ihm; die früher anderer Meinung waren, bekannten 
ihren Irrthum. Schliesslich sagte der Scheich zu Gamila: ,Hast du 
dir eingeprägt, was ich da gesagt habe?' ,Jawohl!' antwortete sie, 
,und ich bitte Gott um Vergebung/ ,Nun denn, so schliesse unsere 
Versammlung mit einem schönen Lied/ 

Wir haben so weit ausgeholt, um den Standpunkt für die fol- 
gende Erzählung zu gewinnen, in welcher die Darstellung jenes 
Gegensatzes in nicht so durchsichtiger und doctrinärer Weise, wenn 



> <u 

=> o 

— o 

CO 



auch immer genug klar hervortritt. Der hi&azenische Sänger Mälik 



03 



fU 



b. abi-1-Samh, Anhänger der 'abbäsidisehen da'wa, zog zur Zeit des 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



134 Ignaz Goldziher. 

Abu-l-'Abbäs al-Saffäh von Medina nach dem 'Irak. Am Donnerstag 
pflegte er seiner Reisegesellschaft zu sagen: ,Es naht jetzt der Abend 
des Freitags. Ich weiss, dass ihr von mir Gesänge wünscht; aber 
ich singe um keinen Preis am Freitagabend (dabei leistete er die 
schwersten Schwüre). Wollt ihr nun etwas von mir hören, so denkt 
eure Wünsche jetzt aus, so lange noch Zeit ist/ Das thaten auch 
die Leute und er sang ihnen bis nahe zum Sonnenuntergang. Dann 
schrie er in übermüthigem Ton: ,Der Feuerbrand ist im Hause von 
Salmagän/ (^l*-*l£ J> ^i Jfer^) Nichtsdestoweniger setzte er seinen 
Gesang fort; niemals sang er mehr als in dieser Nacht, trotz der 
schweren Eide, die er geleistet hatte. 1 

Die Anwandlung von Musikflucht, die den Sänger bei seiner 
Entfernung vom IJigäz und seiner Annäherung an das strenge 'Irak 
wenigstens am Freitag 2 überkommt, ist eine Spiegelung des Gegen- 
satzes der beiden Länder mit Bezug auf die Billigung von Musik 
und Gesang. Der Ausruf 7 Feuerbrand ist im Hause von Sal- 
magän' bedeutet so viel wie: Die Gefahr steht vor der Thür; Jam 
proximüs ardet Ucalegon. 

Aber es ist uns nicht möglich, über die specielle Beziehung 
dieses Ausrufes Genaueres zu ermitteln. 



T3 






Cl 



03 



<=> o 



F P. 



u 

«4- ~° 



<u 



TD 



II. 



Unter den Schilderungen der masslosen Wirkung, 3 welche die 
Recitation einzelner, an sich nicht immer bedeutender Gedichte auf 
Zuhörer übt, 4 finden wir auch manche Einzelnheit aus solchen Vor- 



1 Ag. iv, 170. 

2 Nusejb (auch dies im c Irak) enthält sich am Freitag des Recitirens von 
profanen Gedichten, Ag. n 146, 10. 

3 Man nennt dies farab\ das Wort wird sowohl auf den excessiven Ueber- 



muth als auch auf die unmässige Kundgebung trauriger Gefühle angewandt; Ibn 

Kutejba, Adab al-kätib, ed. Grünert 22, 12 ff.; vgl. Schol. zu Kutämi ed. Barth, 19, 1. 

4 Z. B. Ag. ix 51, 11; ein Zuhörer wird durch eine Zeile des Nusejb, in 

welcher dieser davon spricht, dass er die Halfter schleppt, um zu seiner Geliebten zu 

gelangen, in solches tarab versetzt, dass er sein Kleid abwirft und durch den Saal 

'-o v 

E-e 

E => 

fD O) 

to _c 

s_ C 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Einige arabische Ausrufe und Formeln. 135 

gangen im Kreise der ChaKfen, sowohl der omajjadischen als auch 
der 'Abbäsiden. 1 

Walid b. Jezid geräth durch den Gesang des Ma c bad in so 
übermüthige Laune, dass er sich wiederholt in ein mit Wein gefülltes 
Bassin stürzt, an dessen Rande die Unterhaltung stattfand. 2 Freilich 
unterlässt er es nicht, den Künstler zu erinnern, dass man solche 
Hoferlebnisse nicht ausserhalb des Palastes erzählen dürfe. Auf Ge- 
heimhaltung solcher Belustigungen legten sie viel Gewicht; 3 sie er- 
schraken bei dem Gedanken, dass die Kunde von den weinseligen 
Unterhaltungen des ,Beherrschers der Rechtgläubigen' mit dem leich- 
ten Volk der Musikanten ins Publicum dringen könnte. 4 

Jezid IL Hess sich einmal von demselben Ma f bad ein lustiges 
Lied vorsingen; dabei verfiel er in so ausgelassene Stimmung, dass 
er mit seinen Sclavinnen sich im Kreise herumdrehte ,wie die Kinder 
beim Spiele zu thun pflegen 4 ; dabei sang er ein Lied, 5 das vielleicht 
der früheste litterarische Beleg für jene Art von Gedichtchen ist, 
von denen wir aus dem Munde der Strassenjugend in Kairo ZDMG. 
xxxiii 608 ff. Beispiele gegeben haben. 

Ueber denselben Chalifen ist uns noch eine andere Erzählung 
dieser Art überliefert. Einmal wurde er durch die von den zwei 
Hofsängerinnen Habäba und Saläma vorgetragen Lieder des Ma'bad 
so übermüthig, dass er ein Kissen von seinem Sofa nahm, es auf 
seinen Kopf legte und sich so im Kreise drehte immer tanzend und 



ö. 2> 



Q. 

^ fl) 



w I 

, O) 
O u 



O o 

c v> 
o E 



(T3 



F P- 



schreitend die vom Dichter geschilderte Bewegung darstellt; ja sogar das Gelübde 
thnt, bei jedesmaligem Hören des Verses diese Scene zu wiederholen. Ueber tarab, 



s. auch Ag. ibid. 55, 1 ff. 
(6 ^ 



4 Ag. in 99, 15; v, IG 16. 



1 Vgl. Gähiz, Buchalä ed. van Vloten 129, ein omajjadischer Prinz zerreisst 
beim Hören eines Gesanges aus lauter Lustigkeit sein kamis und veranlasst seinen 

inaulä dasselbe zu thun. Massloses Betragen des Harun al-rasid bei solcher Gelegen- 

v 

heit, al-Mahäsin wal-addäd, ed. van Vloten 298, 3. 

2 Ag. i 27; in 98. 

3 Ag. ii 124, 22; vm 162, 6. 

1 1 ß Ag. i M ^ ^SL~l & b ' ^ ; b b. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVi. Bd. 10 

■g £ 
o c 

E => 

fD 0) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



u 

«4- ~° 

O <L> 

'i/i öi 



136 Ignaz Goldziher. 

die Worte rufend: ^IIä. jlko jOs JU> ; \ ijojl ,j;^kJ\ ^^Jl ? Vier rutl 
frische Fische bei Bajtär IJajjän'. 2 In anderen Versionen dieser Er- 
zählung 3 lautet der Ausruf anders: J^t <J* v*X^-**J\^ i5**Jl* cj»oJI 
O^- ,Hirse um Dattelkerne und Fisch bei (^ ist wohl Schreib- 
fehler für J^) B i (auch der zweite Eigenname scheint ver- 
schrieben zu sein). Baitär ist hier nicht Bezeichnung des Gewerbes 
des IJajjän: (Thierarzt, das Wort mttsste in diesem Falle den Artikel 
haben), sondern ist ein Theil des Eigennamens selbst. 

Der gutgelaunte Chalife ahmt hier den Verkäufern (sie tragen 
das Behältniss der ausgebotenen Waaren auf dem Kopf) und ihre 
Marktrufe nach, ähnlich denen, mit welchen uns Wetzstein in 
seinem schönen Aufsatz über den Markt in Damaskus bekannt ge- 
macht hat; 4 Bajtar Hajjän ist wohl der Name eines zeitgenössischen 
Fisch- oder Gemüsehändlers (bakfeal) der Chalifenstadt. Dass mit 
diesen Rufen die Nachahmung von Marktrufen beabsichtigt ist, zeigt 
uns eine andere Erzählung, 5 nach welcher ein durch Wein und Ge- 
sang erheiterter Mann seinen Mantel abwirft, eine Bettdecke über 
den Kopf legt und ,nach medinischer Art ruft: ^S^Jb *f*^V. Hier 
wird nicht Hirse (cr*°), sondern Lübija-Bohne um Dattelkerne 
angeboten; es ist nicht unmöglich, dass in den oben angeführten 
Stellen das fragliche Wort in der That in diesem Sinne emendirt 
werden müsse. 



■o 



Q. O) 



o -ö 
3 * 



w i 

fN U) 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 

* Ag. xiii 161, 9 v. ii. 

F p. 



2 

* Ibid. 160, 5. 



1 In den Nawädir al-achbär (gedr. am R. des Muftd al-'nlum wa-mubid al- 
humüm, Kairo 1310) 111 unten, steht statt ^lla. ^Iko j^lc ,beim Gemüsehändler* 
JlLJl. 



4 ZBMG. xi 475 ff. 

ö Ag. xxi 163, 15 ^-Üb ^jJ\ XJbj^Jb c Loj> U* C^sT^. 
6 Es kann kein Zweifel darüber sein, dass das unverständliche J^$\ der 
Ausgabe mit K. in «^.jJl zu verändern ist. Vgl. Nihaja, s. v. n 13 j+s. v^OwXa* ^i 

j^S^S jXiJb yb JJfj -Uo^JLH ^31^ gSiJb ^jJl \^> ^yÜb UJ ^X&\. 
Nach LA. s v. v 362 ist die Aussprache mit Kesr ^^sa^aiJl ÄJUJl: diyr. 



o 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 
TD 



t! öl 



T3 
Q. 



03 

s— 
O 



F P. 



u 



Einige arabische Ausrufe und Formeln. 137 

III. 
Eine Schwurformel. 

Von den gewöhnlichen Schwurforraeln, die aus altarabischer 
Zeit überliefert sind, hebt sich durch ihre Seltsamkeit ein bei Ibn 
Rosteh 1 und Ibn Kutejba 2 verzeichneter Gähilijja-Schwur ab, lautend: 
jojJLIj U^-« J^i-t ^^ l^Vj ^ ?Bei den beiden Kleidern des 
Walid, dem abgenützten und dem neuen*. 

Diese Schwurformel scheint ihre nähere Beleuchtung aus fol- 
gendem Verse des A'6ä gewinnen zu können : 



,Bei den zwei Kleidern des Einsiedlers der finsteren Nacht 7 
und bei dem, was gebaut hat Kosajj allein und der Gurhum-Sohn 8 
(bei der Ka'ba)/ 

Für den Einsiedler der p haben andere Versionen ,den Ein- 
siedler der Wallfahrt* 9 oder ,den Einsiedler von Syrien*; 10 aber der 
erste Theil des Schwures ,bei den zwei Kleidern des Einsiedlers* ist 
allen Versionen gemeinsam. 

Zur Erklärung der in diesem Schwüre enthaltenen Redensart 
dient die Thatsache, dass der Einsiedler, den in der Regel die härenen 



1 Bibl. geogr. arab. ed. de Goeje vii 191, 12. 

8 Ma'ärif ed. Wüstenfeld 273, 16. 

8 Mäwardi ed. Enger 277, ^^ cSJLLä.- 

4 So Bekri 489; desgleichen in einem Citat bei Anbäri, Commentar zu den 
Mufaddalijj&t (Leipziger Hschr. D. C. nr. 221) fol. 33 v , und nach freundlicher Mit- 
theilung des Herrn Dr. Geyer im Escorial-Codex des Diwan (fol. G3 1 ). 

6 M&w. 1. c. ajk^.. 

6 Bekri, 1. c. jjtj*. ^ J>UxJl^. 

7 Das Wort kann hier kaum in anderer Bedeutung aufgefasst werden; TA 2 
s. v. ii 92 (ganz unten) Additam. des Verfassers. 

8 Vgl. Zuh. 16, 16 [und Nöldeke, z. St. Fünf Mo'allaqät, in (Wien 1901) 26]. 

9 IM ha* Cod. Leiden nr. 2055, Ged. n v. 44 und — * nach Geyer*« Mitthei- 
lung — auch die Kairiner Hschr. des Diwans. 



10 Mäwardi 1. c. f UJ» s-^j- 



II - 10* 

o c 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






LH & 

° D ! 

fN CO 

f\l ^ 

, O) 

i fO 



o 5 



fO 



u 



138 IGNAZ GOLDZIHER. 

Kleider, 1 die er trägt, charakterisiren, in dieser Beziehung auch 
specieller ,der mit den zwei härenen Kleidern' genannt wird: ^S 2 
j^ft-Ull, ol/^ ^- 3 I n die Reihe dieser Benennungen stellen wir 
das Epitheton ^SSlap-Jl^ das man (nach der Ueberlieferung, Mu- 
hammed selbst), dem in der Umgebung des Propheten sich aufhal- 
tenden Büsser 'Abdallah (früher f Abd al- f Uzza) b. l Abd Nuhm al- 
Muzani ertheilte, 4 der nach seiner Bekehrung sich an der Thüre des 
Propheten aufhielt und fortwährend Lob- und Busslitaneien schrie, 5 
sodass ihn mancher für einen Heuchler hielt. 6 Allen den bei den 
Ueberlieferern angeführten Erklärungen des Epithetons ist wohl die 
Einfügung des ,Mannes mit den beiden härenen Kleidern' in die hier 
zusammengestellte Nomenclatur vorzuziehen ; es wird ausdrücklich 
angegeben, dass >\*£ ein Aequivalent von j!** sei. 7 Es ist zu er- 
wägen, ob die Zweizahl der Mönchskleider in dieser Schwurformel, 
sowie auch die der Kleider, die der Orakelwerber von den Tempel- 
hütern des Galsad-Idols erborgt, 8 nicht einer besonderen Beziehung 



1 musüfi. S. Revue de VHistoire des Eeligions xxxvn 315; amsdh Hassan b. T. 
25, 7, Lebid, App. 12, 5. — Das hebr. ptr als Buss-, oder Trauerkleid wird von den 

_c o 

arabischen Bibelübersetzern in der Regel mit moo, noa übersetzt. Z. B. Sa'adja 
Gen. 37, 34; Jes. 3, 24; 15, 3; 20, 2; 22, 12; 37, 1. 2; 50, 3; 58, 5; — Ps. 69, 12; 
Hiob 16, 15. Oxforder Cod. Hunt. nr. 206, Joel 1, 8. 13; Arnos 8, 10; Jona 3, ft; 
Abulwalid, Usul s. v. pfo erklärt y& nnnc Ps. 30, 2 mit l -ä?"~ . 

2 Gerir bei Ibn Hisäm 385, 4. 
8 Gahiz, Bajän u 130, 7. Die ^\. „U gehören ständig zu den Attributen 

der Büsser. Z. B. Mahäsim ed. van Vloten 221, 6. — Der Einsiedler in der Wüste 
ist bekleidet mit ^JJ] £^T*^ ^^ n % Kaud al-rajähin nr. 103 (ed. Kairo, Casteltj, 



149 ult 

* I 
- "r? 

F P. 



1297) 95, 7; der König, der seine Herrschaft mit der Lebensweise eines Büssers 
vertauscht: Jr&Z^ o**-^ v*Xi^J\ i^LJ ^ ^U ^\S U £jj ibid. (nr. 109) 



4 Ein Regez-Citat von ihm LA. s. v. r\> in 91. 

5 Usd al-gäba in 123 o\j£JL> dö^ jä.j> C^ 3 ?*&"* *>Ü\ J^* * ta fj-Ai 

Vgl. auch ibid. i 56 unten n 138. 332 (wo cr o\}^\). 

6 Die Verdächtigung werkheiliger Leute als Heuchler ist in der alten Zeit 
nicht ungewöhnlich, ZDMG. xliii 650; vgl. eine Erzählung und dazu gehöriges Ge- 
dicht aus der Omajjadenzeit über einen heuchlerischen näsik Ag. xv 17. 19 ff. 

7 Ibn Hisam 905, 7. 

ro ■£ ' 

8 Jäliüt ii 101, 8. 

.E -ö 
-ö v 

E-e 

E => 

fö O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



TS 






■o 

Q- 



.TU 






(T3 



F P. 



u 

«4- "ö 

O <L> 



CÜ 



T3 



Peinige arabische Ausrufe und Formeln. 13,9 

entsprechen, und demnach nicht unter den allgemeinen Gesichtspunkt 
gehörten , den Wellhausen für den Dualis taubän im arabischen 
Sprachgebrauch festgestellt hat. 1 Der Heide schwört auch bei den 
zwei Kleidern seines Götzen. 2 

Die Berufung auf Walid in der hier behandelten alten Schwur- 
formel ist lediglich durch das Homoioteleuton (joj^i.1^) hervorgerufen, 8 
und kann nicht, wie dies im Zusammenhang, in dem Ibn Kut. die 
Schwurformel verzeichnet, versucht wird, auf einen bestimmten 
Träger dieses Namens, W. b. al-Mugira, bezogen werden, der in 
einer völlig unzuverlässigen Ueberlieferung als Urheber verschiedener 
Rechtsinstitutionen gerühmt wird. 4 

Es kann nicht als Zufall betrachtet werden, dass noch in spä- 
terer islamischer Zeit die beiden Kleider des Einsiedlers ganz in der 
Weise erscheinen, wie sie in der Schwurformel näher beschrieben 
werden. Ein verzückter Sufi-Einsiedler in Alexandrien wird nämlich 
in folgender Weise geschildert. Er hatte zwei kamise; das eine, das 
er auf dem blossen Körper trug, war abgenützt, das andere war 
neu; jenes zerriss er (im Zustande der Ekstase) in Stücke, das an- 
dere Hess er unversehrt. 5 

IV. 
Zauberformeln, 

1. o^^ Uj-iil Uc ^o\ ,0 ihr beiden Kinder des Augen- 
scheines (?) — lasset rasch Klarheit kommen', soll ein alter Zauber- 



1 Wellhausen, Heidenthum 1 , 117 Anm. 

2 Insofern man im Schwüre des Sanfara, Jäküt i 340 ~*a>wsVl ^j*$J* A ^ 
das ursprünglichere (gegen ulyfL) halten kann. 

3 Aehnlich wie im Schwüre ,bei Chälid b. Walid', Landbeko, Aratrica iv 142 



penult. im Reime mit joj»^.. 

4 Es wird ihm z. B. die Einrichtung der Kasäma zugeeignet, was Wüstenfeld, 



Register zu den Genealog, Tab. 461 s. v. dahin missverstanden hat, dass man ihn für 



den Urheber der Institution des Schwures hält. 

*— o 

5 Al-Dabbi, ed. Codera nr. 308 (p. 132 unten): ^\S^ J^ ^JU ^-^^ 
A3 1+3 /$M*\ L J\ SJo- — Ueber das Zerreissen der Kleider im Zustande süfischer 

E => 

ro <V 

to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



140 IGNAZ GoLDfclHER. 

spruch sein, den man bei verschiedenartig angegebenen Augurien 
anwandte. Die alten Philologen haben einander widersprechende 
Angaben über die Bedeutung des Ausdruckes ^U* Lo\. Nach einigen 
sollen damit Vögel gemeint sein, nacli auderen zwei Striche, die der 
Zauberer auf dem Boden zog; nach anderen gehört der Ausdruck 
zur Terminologie des Glücksspiels und bedeutet zwei gewinnbringende 
Pfeile. Noch andere meinen, zwei Dämonen hiessen ibnä 'ijän; diese 
wurden beim Augurium angerufen. 1 Man ersieht aus der Mannig- 
faltigkeit der Versuche, diesen alterthümlichen Ausdruck zu erklären, 
dass die richtige Ueberlicferung seiner wirklichen Bedeutung bereits 
abhanden gekommen war, als die Philologen die Reste des Alter- 
thums sammelten. 

2. Sprüche gegen den , bösen Blick*. 
a) Die abergläubischen Vorstellungen der Muhammedaner über 
den , bösen Blick* hat am eingehendsten Kremer erörtert. 2 Unter 
den Namen, mit denen man im Arabischen den bösen Blick (ge- 
wohnlich ^^ und <^, 3 seltener ^j^Jü 4 ) bezeichnet, ist am meisten 
charakteristisch die Bezeichnung per antiphrasin, als: JU-&1 ^^ 
,Auge der Schönheit*, 5 als wollte man den ominösen Charakter der 
damit benannten Sache durch diese euphemistische Bezeichnung 
schon von vornherein abwenden. Abu Bekr al-Chwärizmi sagt in 
einem seiner Briefe: ,0 Gott! erbarme dich der Verstorbenen, denn 
du bist barmherzig gegen die Edeln, gnädig gegen die Leute des 

Wohlthuns; und behüte die am Leben Gebliebenen vor dem Auge 



Ekstase s. Gazäli Ihjä n, 280—2; D. 13. Macdonald, Emotional Religion in Islam as 
affected by Music and Singing. JEA8. 1902, 9 f. 

1 LA s. v. w^£ xvn 178, Murassa* ed. Seybold 158. 

* Chdturgeschiclite des Orients n 253 ff. Studien zur vergleichenden Cultur- 
geschickte iii/iv 62 ff. Die Ausgleichung dieser im Hadit gebilligten Anschauung 
(JJä. l^aaH ^1) niit den Einwürfen des Rationalismus bei Fachr al-din al-Razi, 
Mafätih vni 278. 

8 Alte Stellen bei Zarkani zu Muwatta' iv 153, 7 ff. 

4 Ibn Kut. Adab al-Kätib, ed. Geünert 22, 7. 

m 4-1 ** 



ti öl 



o -ö 

^ fl) 



O) 

o u 



O o 

c v> 
o E 



5 Lane v 2216% vi 2423* unten: ,an eye believed to liave the power of 
killing by its glance. 4 

E => 

fD O) 

l/l 4-1 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Einige arabische Ausrufe und Formeln. 141 

der Schönheit, denn es ist die grösste Gefahr für den Menschen'. 1 
Guzüli verzeichnet folgenden durch die Erfahrung empfohlenen heil- 
samen Brauch: Wenn jemand ein Haus baut, so möge er an der 
Front eine kahle Stelle übrig lassen, um das Haus vor dem Übeln 
Einfluss des Auges der Schönheit zu beschützen'. 2 Und \Abd 
al-I£ädir al-Bagdädi erklärt bei Gelegenheit eines Verses des Gemil, 
in welchem er seiner Geliebten Butejna den Wunsch ausspricht ; Gott 
möge ihr Splitter in die Augen senden' u. s. w. solche in der ara- 
bischen Rede häufige scherzhafte Flüche (wie *I)t AJ3U* u. s. w.) 
damit, dass man einem Ding, das eine vollkommene Stufe erreicht 
hat, scheinbar flucht, um es vor dem c ajn al-kamäl zu schützen. 3 
§afi al-din al-FJilli sagt in einem Gazal-Gedicht, 4 dass er nach der 
Aufzählung so vieler rühmlichen Eigenschaften nur deswegen auch 
einen Fehler folgen lässt ,um den Gerühmten vor dem c ajn al-Kamäl 
zu bewahren'. 

Die alten Synonyma für den Begriff jemanden mit dem bösen Blick 
treffen' und ? von dem bösen Blick getroffen werden' sind bei Ibn 
al-Sikkit ed. Beyrut 545 f. in einem eigenen Kapitel (^UoVl\ v-A> 
o^*^) zusammengestellt. Aus der Litteratur kann noch einiges hin- 
zugefügt werden, was für die Vorstellung der Araber über die vom 
Blick ausgehenden schädlichen Wirkungen charakteristisch ist. Ag. 
xv 19, 17 £*U 0>* JU*o e£*J\ \^kS (ljamza b. Bi<J), als ob der böse 
Blick ein tödtliches Gift enthielte. — *-^*? o-^** 1 schleudern, mit 












w i 

fN CO 

O u 



o o 

c v> 
o E 



F P. 



u 



> <u 

=) O 

' o 



1 Rasä'il al-Chwärizmi (Stambul 1207) 162, 15: jXJli «^UJl ^j* r ^\ 
l^li <JU5Ü\ ^ ^ J>l*i\ ki^ * f UWl Ja\ ^ ^ * f \yüb ^j 

* Matali* al-budür i 9: \j\> ^j^.\ LS JJi>\ »5\ Ä^äZJI JaI J**o JISj 

8 Chiz. ad. m 93 oben: ^^ ^ U^i> ^U ^JO <^.^ £^ W \y*&Jt O* 
JL*5Ul. Dafür findet man ein interessantes Beispiel aus dem Leben bei Dämiri 
s. v. l31Lä*, i 327 ganz unten. 

4 Diw&n (Damaskus 1297—1300) 282, 4. 



.c ^ 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 



ö. ^ 
.c o 



o 

5 S 



03 



fD 



142 loNAii GoLDZJHEH. 

etwas bewerfen 1 (Mejd. 1 n 304 ult.). - ä^ *\$£ versengen (s. die 
Lcxx. s. v.); auch in den heutigen Beschwörungsformeln wird der 
böse Blick wiederholt mit den Worten , -glühender als' gekenn- 
zeichnet 2 — Wir werden bald sehen, dass in der späteren Sprache 
auch das Verbum 3 <-^i> in der Bedeutung ? mit schclen Blicken an- 
sehen' gebraucht wird; »J^U* — ^y^; ^^j^ = o*^-* oder o^*- 

Auch Koran 68, 51 f-*,U*>b *^$*SjJj wird von mehreren Exe- 
gcten auf den bösen Blick gedeutet; aber keinesfalls steht diese 
Anwendung mit der Bedeutung von JyJj iv (zu Falle bringen, aus- 
gleiten lassen) in Zusammenhang. 

b) Schon die heidnischen Araber haben Amulette gegen die schäd- 
liche Wirkung des bösen Blickes gebraucht. 5 Nach einer sehr schwach 
bezeugten Nachricht sollen sie in den Bart einen Knoten 6 geknüpft 
oder Pfeilsehnen um den Nacken gelegt haben, um den bösen Blick 
fernzuhalten. Diese abergläubischen Bräuche sollen im Islam, der 
übrigens die Thatsächlichkeit dieser Bezauberung zugestand, in Form 
eines Hadit untersagt worden sein. 7 Besonders den Asaditen eignete 
man die Fähigkeit des bösen Blickes zu; sie sollen sich zu dessen 
Ausübung durch dreitägiges Fasten vorbereitet haben. 8 Dass man 



o -ö 
3 * 

^ (D 

m </» 

° ^i 

fN CO 
f\l ^ 
, O) 

O o 

c v> 
o E 

^-^ 4-1 

T3 ±3 
■jn _£ 

Bedeutung verzeichnet er nicht, 

F p. 



1 LA. s. v. äaJ, ix 197. Nacli Abu 'Ubejd wird dies Verbum in der Be- 
deutung schleudern nur vom Mist und dem bösen Blick augewandt: ^ jj A v .> J 
Jy^Jl ^ Cr ^\ £}U>\ <J ^\ ££1)1. 

2 Katä'if al-latä'if 211. A\ .^ ^1 mit verschiedenen Gegenständen fünf- 
mal wiederholt. 

3 Dozy, s. v. ii 37 b unten, weist nur an einem Beispiel für das Substantiv 
L_slL die Bedeutung ,inauvais oeil* nach; die Anwendung des Verbums für diese 



4 In Flügels ConcordanUae Corani (wenigstens in der 1. Aufl. v. J. 1842) fehlt 
diese Form, sowie überhaupt der Stamm .£3;. Das Wort ist unter k*JA\ als 
v*JoyUj.^J verzeichnet. 

5 Wellhausen, Heidenthum 1 , 143 ff. 



O <L> 

6 lieber Zauberknoten vgl. Mittheilungen der Anthropologischen Gesellschaft 



in Wien xxxi (1901) [137]. 



7 Nihäja s. v. J^, iv 192 zum Hadit ljj£ jJJo ^\ 4JUi. jJU ^x>: — \$i\S 



<£}> ^ ^-^ *jl£jl n*^ £*^ Cr'Z*^ hi J^V^i *>*SSÜ\ O* O^Ü' 



8 LA. s. v. JyJ i: , xii 10 unten. 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Einige arabische Ausrufe und Formeln. 143 

im Heidenthum auch Zaubersprüche anwandte, lässt sich nicht 

nachweisen. Dagegen ist in den ältesten islamischen Hadit-Docu- 

menten von Rukja gegen das böse Auge mehreremal die Rede ; 

eine bestimmte Formel ist jedoch an der Stelle, die Kremer dafür 

angiebt, nicht überliefert. 1 Interessant ist folgender auf Asina bint 

'Umejs zurückgeführter Bericht: Der Prophet drückte einmal der 

Nu'mä, Tochter des Ga'far b. Abi Tälib seine Verwunderung darüber 

aus, dass die Kinder des Ga'far alle so dürr und mager sind, als 

wenn sie sich nicht satt essen könnten. Nu'mä erwidert ihm, 

dass diese Leute allerdings keine Noth litten, ihr mageres Aussehen 

aber die Folge ihrer Empfänglichkeit gegen den bösen Blick sei 

(crz**^ r**^ tr""**)- ? Soll ich sie vielleicht besprechen?' Zugleich 

schlug sie eine hiefur geeignete (in religiöser Beziehung) unbedenk- 

liehe Formel vor (<^ <_r*b ^ Uü5 ^U c^o^äb ^^lil). Der Prophet 

erlaubte ihr, diese Formel anzuwenden. 2 Der Text derselben ist 

nicht mitgetheilt. Die spätere magische Praxis hat eine Menge solcher 

Zaubersprüche ersonnen, welche neben den Texten der geschriebenen 

Amulette, Zauberquadraten (^UL) und anderen Mitteln in der be- 
iz o 

treffenden Litteratur reichlich mitgetheilt sind. 3 

Einer der ältesten Zaubersprüche scheint folgender zu sein: 4 
«^r-ob*. ^jr+J^. B [ 4 IS *JJ\ -LA u ^U^JI ju>jJii * UJl r&s. ^JJ\ ^b] 

«,>j '^ ^UJl ^ 0>3; J>\ ^\ <1^\S V V*t^ '^b 6^ 

> 

1 Muwatta' iv 152; Kremer, Studien 1. c. 64. 
* Usd al-gäba v 396. 556. 

3 S. besonders Ahmed al-Dijarbi, Mugarrabät (der volle Titel ist: oXX^il J& 
j^u*a)1 gjLJ «^jJ^Jl w x^älJ\, lith. Kairo 1313; über den Verf. — st. 1151 — 
s. 'Ali Mubarak, Chitat gadida xi 72) 58—60: jj\^ ^3 0ir *£cRJ\^ ^$>\L\ i^AJl 
*Ja*J1^ l ^^Jt)b jJpLJk&K 

4 Vgl. Damiri s. v. l^. i 251 oben, Zahl* al-kimäin fi Kissat Jusuf c alejhi 
al-saläm (Hschr. der Leipziger Universitätsbibl. D. C. Nachtrag nr. 7) fol. 141 v . 

5 Parenthese bei Dam. 6 Dam. Dijarbi: ^ ^c- 

7 Vgl. in der grossen Amulettformel al-higäb al-a'zam: Lla. b K *£JL*sr* m + 

^-Jflj ^L^-*io . . . J-**^ & >\\\ ±yo C^ycj^ • • . * >Lsvl.\ \ jjfc al-'Amili, Michlät 

(Kairo 1317) 147, 6. 

8 Dam. ^i «. ö Zahr (?) Jfe-i*, ^^ J^ f ^ ^^ ^i.. 

.E "o 
-ö £ 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



T3 
Q. 



F p. 



u 

«4- "° 



0) 



3 „ 

o 






w I 

fN CO 

f\l ^ 

, O) 

O o 

c w 

o E 



F P. 



u 

«4- "° 

O <L> 



144 Ignaz Goldziher. 

^^. (oz>?) r*^^ K-J P* '^ Cr* eS/ i> r^" «*£ 1 <J* i * 

Die Formel wird in verschiedenen Variationen gegeben; wir 
wollen versuchen, sie annähernd wörtlich zu übersetzen: 

,Die Fesselung des Gefesselten 3 — und ein trockener Stein 4 — 
und die lodernde Flamme (komme auf den selbst, der den Zauber ver- 
übt hat). — Gott, ich schleudere zurück das (böse) Auge des Be- 
zauberen auf ihn selbst und auf die Menschen, die ihm am theuer- 
sten sind — in seine Leber und seine Nieren. Möge sein Fleisch 
mager und mögen seine Knochen schwach werden und seine Thiere 
keine Milch geben. Kehre zurück, du Blick (auf den Zauberer); 
siehst du irgend eine Spalte (durch welche du zu ihm ziehen kannst)? 
Nochmals : Kehre zurück du Blick (zweimal) ! Möge der (böse) Blick 
sich zu dir zurückwenden, weit weg, und möge er kraftlos sein (in 
Bezug auf den, dem er ursprünglich zugedacht war)!' 



1 Dam. Zahr: j^Jb jJU ^y 

■ Dijarbi: ^^ J\ ^Jl g^U. 

8 D. h. durch Zauber bewirktes Binden der Kräfte de« Bezauberten» in diesem 
Falle gewöhnlich v«ä«» t \\- ein Gegenzauber gegen eine besondere Art dieses zau- 
berischen Bindens ZDMG. xi/vm 359. 

4 Dies ist im Zusammenhang mit einer Formel zu verstehen, durch welche 
böse Omina wirkungslos gemacht werden, nämlich yaai»i ^CJb ,einen Stein in 

deinen Mund* oder ,Staub (< >l JÜ\) in deinen Mund'; dies wird Leuten zugerufen, 

die eben etwas Verhängnissvolles ausgesprochen haben. Diese Formeln sind ZDMG, 
xlh 588 f. behandelt worden. Aus den Materialien, durch welche die dort gesam- 
melten Beispiele jetzt vermehrt werden könnten, will ich bei dieser Gelegenheit 
nur einiges Charakteristische anführen. Als der Dichter Ibn Kajs al-rukajjät in 
einem zu Ehren des Abd al-'Aziz gesprochenen Gedicht auf den dereinstigen Tod 
des 'Albdalmelik anspielt, sagt dieser zum Dichter: yöJJ v£&*i.> (Ag. xvi 60). — 



Al-Nuwejri, Encyklopädie, (Leidener Hschr., 2 b ) fol. 151: ^l ^-Sä L« !*£)> •*+* 

c£*i*> iZ**\ JULi '<L+j6 wJtls j *ojA\ Äiy£> ^^U i—Aj* kjLu) }l uJolkJb 

^tiUl C^-S) \>\ &\ Jyb JIS Jyb U <ul*~t <0 Jtfi ^\yö\ ^\ s^J3&\ 

kifwX^o t^XJl. Ein Stein oder Staub wird auch in den Mund der Schaden- 



> <u 

C CT 

B ° 

frohen oder der Angeber gewünscht. Farazdak wünscht einen ,Fels* in den Mund 

der ersteren JJcuoJt «^JULäJI ,-ib nach der La. in Harn. Buhturi (Hschr. Leiden) 

190, wo im Kämil 128, 5 uJJlJl (vgl. Abu Zejd, Naw&dir 36, 7). Beides zusammen 

'-o v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

— - 

ü Q_ 



Original fronn 



Einige arabische Ausrufe und Formeln. 145 

c) Nicht immer will der mit der Fähigkeit des schädlichen 
Blickes Begabte dieselbe zum Schaden seiner Nebenmenschen ge- 
brauchen; vielmehr will er selbst die Folgen seines eigenen Blickes 
wirkungslos machen. In diesem Falle kann also nicht eine Formel, 
wie die soeben erwähnte, in Anwendung kommen, welche die bösen 
Wirkungen auf den zurückschleudern soll, von dem der Blick aus- 
gegangen ist. Bei al-Rägib al-Iafahäni 1 (st. 502) finde ich eine ziem- 
lich unverständliche Zauberformel für solche Fälle verzeichnet: Y>\ 
O'Vä. ^j^b J>ä-*i ei-^ia-Jl £y*& l3^1D\ Jvä.\ dL^Lo ^s. ^b^ eijJo 

^J^a ^^Lm-Xs. ,Mit einer kam sie aus Medina; mit zweien (fein.) kamen 
beide (fem.) aus Medina, mit dreien (fem.) kamen sie alle drei (fem.) 
aus Medina' u. s. w. bis zu sieben. ,Wenn der den bösen Blick gegen 
das Auge eines andern geworfen, das Auge des letztern anfasst und 
diese Formel spricht, wird sich dessen Auge beruhigen/ Was man 
sich aber bei der Erfindung dieses Zauberspruches gedacht haben 
mag? Er scheint nicht recht durchgedrungen zu sein; denn in der 
Sammlung des Dijarbi habe ich ihn nicht erwähnt gefunden. 

Neben solchen Sprüchen, welche die Aufgabe haben, die Schäd- 
lichkeit des eingetroffenen bösen Blickes wirkungslos zu machen, giebt 
es auch prophylaktische Reimsprüche dagegen. Man findet sie in der 
gedehnten Rakvve, die der in den zehn ersten Tagen des Muharrem 
mit der mej'a mubäraka von Haus zu Haus ziehende .Räucherei^ 2 
während der ganzen Verrichtung seines Zaubers über seine dienten 
spricht. Der ganze Text dieser Rakwe ist jetzt im Buche Ka{ä if 






■o 

Cl 



> 

F P- 



Sibaw. i 132, 11 ^JjJLL.* aL&^Jl *t^d"J v_->j-&- Im Muwatta* in 38 (Mitte) wird 
eiii Rechtsfall angeführt, der sich daraus ergab, dass zwei Eheleute die einander 
zugerufene Ehelösungsformel durch die Entgegnung; *äA.\ <i£^i-> rechtlich wirkungs- 
los machen wollen. Später werden diese Formeln zur poetischen Metapher ab- 
geschwächt, z. B. Abu Temmäm, Diwan 434, 16: 

\*j2 e^iJ^ 'J^ä >*£~i\j} * ^yixsr* ^j-U^Uvö ^J v*£il^ 

Der Dichter selbst ist der Staub und der Stein für den Feind. — Auch in obiger 
Beschwörungsformel ist die Erwähnung des j*sr* als Gegenzauber beabsichtigt. 

1 Muhadarat al-udabä i 95. 

2 Lane, Mannas and Customs i Kap. 11 (5. Auti. London 1871) 317 ff. 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






146 IuNAZ ÜOLDZ1HKK. ElNlOE ARABISCHE AUSRUFE UND FüRMELN. 

al-latä'if 210 — 213 abgedruckt. 1 Einige Elemente aus diesen For- 
meln kommen auch in den Ra^wes gegen den bösen Blick vor, die 
Frau Lydia Einszler in Palästina gesammelt und mitgetheilt hat. 2 
Aber in diesen modernen Formeln ist merkwürdigerweise gar keine 
Reminiscenz an die oben aus der Litteratur mitgetheilten älteren 
Zauberformeln wahrzunehmen. 

1 Diese Zauberformel bietet übrigens einen guten Beleg für die unlängst von 
Baron v. Andrian in seinem Vortrag über Volkszaubersprüche hervorgehobene Eigen- 
thümlichkeit solcher Formeln, dass in ihnen häufig die erzählende Form angewandt 
wird, die dann in einen Dialog übergeht; eine Eigentümlichkeit, die auch an den 
babylonisch-assyrischen Beschwörungsformeln beobachtet worden ist. S. Mittheilungen 
der anthropolog. Gesellschaft in Wien 1. c. [135] unten. 

2 ZDPV., xii (1889) 200—222. ,Das böse Auge. 4 



■o 

Q- 



O o 

c ^ 
o E 

^-^ 4-1 

■o -b 
'£ 2 
§ i 

= i 

- "r? 

£ ö. 

P 

U 

O <L> 

*s 

'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



Bcinas Kärlambari und die Geschichte vom Köni^ 
Sumanas in der Brihatkatha. 

Von 

L% v. Mankowski. 

(ftc-llIllSH.) 

IL 

1. Der Text der Sumänasäkhyäyika in Kshemendras 
Bphatkathamanjari. 

Vorbemerkung. Der hier zum ersten Male veröffentlichte 
Text der Geschichte vom König Sumanas oder Sumänasa aus Kshe- 
mendras Brihatkathämanjari ist derselben Handschrift entnommen, 
aus der ich dessen Auszug aus dem Pancatantra veröffentlicht habe, 
nämlich dem Manuscript B, I. O. L. Coli. Bühler, Nr. 71, einer 
modernen Copie des 16. Lambaka, die mir vor einer Reihe von 
Jahren der unvergessliche Bühler zur Benutzung überliess. Ich 
habe mir damals den Text der Sumänasäkhyäyika, der auf Blatt 24, 
Zeile 8 beginnt und auf Blatt 33, Zeile 3 mit dem Titel dieser 
Erzählung abschliesst, genau abgeschrieben, und nach dieser meiner 
Copie gebe ich jetzt diesen Text heraus. Die Handschrift B ist in 
meinem Auszug aus dem Pancatantra eingehend beschrieben, worauf 
hier verwiesen sei (s. daselbst S. xi f.). Ueber den hier folgenden 
Text habe ich nur zu bemerken, dass die Doppelstriche und die 
Zahlen am Schlüsse der Verse von mir hinzugefügt sind und dass 






o -ö 
3 * 



w i 

fN CO 

O u 



o o 

c v> 
o 2 



> <u 
=) o 



im Uebrigen alle, auch bloss orthographische Abweichungen der 

ru 



Handschrift von dem gedruckten Texte sich in den kritischen Noten 



fT3 

verzeichnet finden mit alleiniger Ausnahme der Fälle, wo B im In- 

E-e 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



ö. 21 

ü Ol 



148 L. v. Ma&kowskt. 

laut statt eines Nasals und in der Pause statt m den Anusvära hat. 
In der Orthographie hin ich der Autorität der Petersburger Wörter- 
bücher gefolgt. 

ttot nrenrereret ^*ret *nret f*rf>*: h * u 
7i ^rf^rewref^nf mn^reT i 
^trit JjTrrwr *rre inftff^r ^f^rr u ^ « 
iiw *rere"re -^n« *K*d^PiH i 
^rt: unrer ifnrre ircrer «nNOMfiiH ü 3 « 
*j«fat |^f N1 t nrernre^T**nT: i 
TW5*rt *jf*nrrcrei w*; f*re$ jt: h 8 ii 

Tnrr * ^s: jfnmr ^nrnwt f*ret i 
, *f% f*re<ft »rr* ««Krey*i<jq\ n $ ii 

arnrett innrer JJ^MiH^ftwi: h <o n 

^rert gppftfnnre^re *r?*re: i 

Tf^mT ^«^^nj *rrre ^ft ire^rere: ii « n 

^Tf^«^«i«ireÄ*R *ifärf^re?rf^% i 

fTre^r^ffrt: gf%^: ftflMlfilfii: n s. h 

^n;ffnn^%%^ wnur *nfr*f*i i 

tfncnfrz*Tf*nflnn *förn!nrifwr: »wt: u qo ii 

tttt: ^reröir: 5|«iT?qf<TfT: xnsNhre i 

^TTg ht^t ifaftt *jf*reT *wrf*nrr II w II 

jrnChrenwT 7n»T^ wrnre: wtrero% i 

f^: *re resref * nr r *ini fi^njwr « <r ii 

*n<a«fi pftn§t ijf; ^re»nt ^rei: i 

Tre ^rnsf innj: ^vrv üwwt fsprr: ii s? i 

^rewnpwMn*ii^irwoc^: ^ : ' 



13 -D 
in <n 

° 3 I 

fN U) 

r\l ^ 
, 0> 
^ U 

O o 

c w 

o E 

cu 'z 

TD ±3 

'(/) ^ 
i_ 
CD 
> 

= 1 

- "r? 

£ ö. 

P 

cd ^ 
U 

O CD 

*s 

'i/i öi 

CD ? 

> CD 

C CT 

3 O 

— O 

c O 

CO 

.E -ö 
-ö £ 

E-e 

E => 

CD CD 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

CD 3 

ü Q_ 



Original from 



0) 
■D 



ö Ol 



Q- 



.TO 
CT! 



° O 



(T3 



BÄNAS KaDAMBAKI ETC. 149 

^rf^JWT^r *iJTO*ftfwrfarrcrrcnT: II S8 II 

g*: wrf^Tf^tV^rf^wmMT^*^^: H «im ii 

fa^fcft f^WR^TTTfcTfwmrfa: ii ^ M 

faf^rar ^f^Pf *ref fagsf im ^tr^*i ii q^> ii 

^af fä*rt f^WF^f^fatT* n qc ii 

Tra: tPR%*Pr tjttNt wrt 5 ^: n «to. « 
vt^* $* uro t^^nsr *Tfa wnr i 
wrafw^rerrnnp«^ ^«rerrercnr ii ro ii 
<Hftn*fti!r*P?f¥ ^ f^^reraf f*pjfar *: i 
mrafei^i^iami: ^rncw '«ftaiT^ft* ii ^ u 

TrepRTrf*wRtf% ^fonf*T3rwrftre: ii r? ii 

^T%«T *fpR^rft ^Tf^r^TfJ^rRfTT II ^3 II 

^r* 3f*niifwwr *nfar tott^t i 



^T rTrSfER: H*t *r*R*TT ^%W II *1 II 



= 1 

- "r? 

£ ö. 

P 

U 

O <L> 

*s 

'i/i öi 

> <U 

C CT 

3 O 

— O 

c O 

.E -ö 
-ö v 

E-e 

E => 

fD O) 
i_ c 

1 S Digilized by ^.OOglC CORNELL UNIVERSITV 

<= .Q 
(1) = 
O Q- 



^rf% ^ftfafrWTWT* »pft^t frfä?rf*^: ii ^ ii 

ff ff*T TOTOTOt »TR^RR^i: WTr\ II ^ II 

siTrfof Tf***rrwT* <tot *TWTf^r ^tt: i 

TffT rrar^'f ^TT **#t TT* $<* ^ t II V= II 



Original from 



150 L. v. Majakowski. 

*?N fl<g<j3*!i<i*ii irfJpNRn n *o. 11 

Tfte^*^<*<«*iO' ^pn *t 'aftt^nr scft ii 33 ii 

TT fTT^pr fawwrt thcw *tf*nn *jf*r i 

<ttt: Twprnrf *>t*tt% iffawff^nTT*T i 
*T^rcfttf jprftf* mt *T ^tfa %^r: h & ii 

Tf fwaxi ?r$ ^rrwt vr^f^t^ ii ^ ii 

^rcfrfa g<^i ^nsmwr <sftfa?r. wk- i 8<> « 
w *rt*pH$Rwr 3 *Nft nurr ^ff^rr: i 

^(qnpnert fw^nirarRrt -h-« i*i*n i 
*fi&#* ^% fa* *f^t*r *t *reft ii 8? ii 






■o 



.TU 



c ^ 
o E 

T3 t; 

-I 

- "r? 

£ ö. 

P 

U 
O <L> 

*S 

■h! ■— 
'i/i öi 

a 
o 
o 

c O 

£ -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0) 
■D 



ö Ol 



Q- 



.TO 
CT! 



Bänas KadambarI etc. 151 

wr fw^F^t ^TfifatTR^rmfirfa n 8M h 
*nfrr«nwr fäfwRf%f*nrw^RT ii 8$ ii 
^rqi^HM^Yei tt^t: **f^r: ^f?r: ii 8^ ii 
ii<T^#^nwr^r *tt TTfiroT fajfrwfa ii 8 c ii 
**ftT*nnn Tn^rr?^f^rr^n *reft* ii 8Q. n 
xrfttenar ftnft ^% *tt *prr ^uf^ww ii mo « 

<r^r<rt TT^nsr^r imfr fw*rr$^: ii mr ii 
^5tT*f^g <^ <><«MM ; ^^ r*re : II M? II 
gt^T^T^ t tN%: TTR ^fa* II M8 II 
Wtf^JHTO ^TT^T^ryW ¥*<l«<ft II MM II 

^nfr ^f^nTT^f wrpws t^t*^ « m$ ii 
üR<i-Hf ^mi4>^- ff wcr^^i i 
f^«*nvK^^di(T *T3*r: ^gt *ret ii m^o ii 
cht: wt f^'üf^TTTT uj-i**f«*<:t^;^T I 

II M^ || 



rN 2 
c ^ 

o E 

(U £ 

£ 2 
§ S 

-I 

- "r? 

£ ö. 

P 

U 
O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 

C CT 

3 O 

— O 

c O 

.E -ö 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 11 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






^ fi) 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c w 

o E 



F P. 



■h! ■— 

'i/i öi 

> <i> 

C CT 

13 O 

— o 

c O 

(0 



152 L. v. Mankowski. 

Wr fim^ *w^t ^ <P*** wi^oi 
*r*nmt TT*ppr. tTrrrf^: *tot1t i 

gftfi ren *t*rer*ä ff w^fhpr. wt » ^ n 
T<g<*>T * ^r. um f^f %*rrat *g: i 
wrfiwt f^n^r tf tt*t* wrnre^ « fc » 

*3w 3t tt*t* 7t *rnt gt^w**. « i$ « 
rnfr f*rot ir^r tot fjtf^j^r^ i 

«* ^ <rt irfiirüir^ t^rrar^TaraT»? i 
•*r«KT » rrerf*r f*wt *fNTt>st t *hnt: i $ c » 

gwT^KT^nfTTit *to* www: « $<£ « 

**w: irwfr^r: *fNn4*Tf^fä: n ^o ii 
*OTTWTOTf«Wr u 



IU — . 

2. Kritische Noten zu dem Texte Kshemcndras. 



V. 2. B gegen das Metrum sabhdstMnasthita- statt -sthitam. 
V. 3. B srakarh marakatachavwh. 

V. 5. B kfitäiiihniko rrija Srivm dhvya und papracha. Statt 
nhüya vermuthe ich dhärya. 



2 T5 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 









Bänas KädambarI etc. 153 

V. 6. B adbhiitarh und hemavati. Dass haimavati zu verbessern 
ist, beweist Kath. 37 hirnavawnikate. — saihsdravipuld = samsdra 
Iva vipuld, ein kühner Vergleich. 

V. 7. B irakalaksha- und ivakendtyamtapeialah. 

V. 8. B jamanihinam avarddhayata und analyatthh statt ana- 
Ipatdm. 

V. 1). B hatenakrodaharinaih: hütend- (d. i. Aato -|- ma) ist kaum 
richtig; ich habe daher hatebha- verbessert. Elephanten erwähnt 
hier Kad. an mehreren Stellen: 27, G. 15. 17; 28, 12, namentlich 
aber 30, 5 aciraprahatagaja- und 31, 5 (jajakumbhamuktdphalani- 
karasandthapdnibhih. 

V. 10. B scheint nirjjwd zu haben. 

V. 12. B mdrieanämrd und gegen das Metrum sahdsa- statt 
sahdsam. 

V. 13. B buvdnam paprachuh. 

V. 14. B abhavat Srimän nanndkarapure und jyotiprabhdkhyo. 
Kath. 59 heisst die Stadt Ratnakara, der König Jyotishprabha. Vgl. 
V. 55 jyotiltprabhasya, ein Verstoss gegen Päuini 8, 3, 45, der viel- 
leicht von Kshemendra selbst herrührt. 

V. 15. B gegen das Metrum kdmtinidhiloka-, — candrdmäa/j. 
lässt sich als Tatpurusha oder als Bahuvrihi (,Antheil am Monde 
habend') erklären. 

u 

V. 17. B priydkardkhyena. Ueber der Silbe khye steht kshe. 
Der Name lautet unten V. 54 und Kath. 64 Priyamkara. 
V. 19. B sphutikasvachavigrahcDh. 



fö 



V. 20. B kaildsa- und apasyams tryambakdlayant. 

V. 21. B tatropavznayamti ca und paprachdkäla-, — yauvanä- 



F P. 



vanim: avani vertritt hier das sonst in solchen Zusammensetzungen 
gewöhnliche bhiimL 

V. 22. B padmakrittdbhidhdnosti. Kath. 86 genau wie unser Text. 

V. 24. B pushydyudha-, 

V. 25. B kampakalikd. 

V. 26. B vudhadattäkhyas. In den Petersburger Wörterbüchern 



C CT 
=> O 

— o 



11* 



fD 

kommt nur Buddhadatta als Personenname vor; vielleicht ist auch 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

a3 £ 

ü Q_ 



Original fronn 



154 L. v. Mankowski. 

hier so zu verbessern. — B kramaöa statt kramasah. Der erste Halb- 
vers scheint fehlerhaft zu sein (der Fehler dürfte in kramasah stecken), 
lässt sich aber erklären: ,Budhadatta gab dessen Herkunft an (und 
erzählte) nach und nach (die folgende) Geschichte/ — B gegen das 
Metrum didhitimdn (Kath. 93 hat didhitimdn). 

V. 27. B sarolakshmi statt -lakshmir. Vgl. V. 62 sarojinyä . . . 
lakshmisutah. — sakdmdydm: B hat nach sa einen verticalen Strich, 
der wie der Anfang eines Buchstaben aussieht und wohl nichts zu 
bedeuten hat. 

V. 28. B hat deutlich saravi statt sakhi. 

V. 29. B nyavedayat jnätvd, 

V. 30. B saSalpevdhitavyathd und lässt hierauf den Interpunc- 
tionsstrich aus. 

V. 31. bdlanalinivalaydlarhkritasthitih : ,seine Standhaftigkeit 
(oder Lebensdauer) war mit einer Einfassung von jungen Lotus- 
pflanzen geschmückt/ Der Nachdruck dürfte auf bdla liegen und 
der Sinn der sein, dass diese Schranken leicht überschritten werden 
konnten, dass mithin seine Standhaftigkeit (oder Lebensdauer) nur 
an einem Faden hing. Vielleicht liegt hier ein Slesha vor, denn va- 
laya bedeutet auch ,Menge' und sthiti auch ,Aufenthalt, Standort'. 
Vgl. unten die sachliche Anmerkung zu diesem Verse. 

V. 32. nijam udydnam: ,in meinen Garten/ 

V. 33. tatra = tasmin, sc. udydne, ist mit -äkule zu verbinden. 

V. 35. B tattanuh statt tattanum. 

V. 36. anale: B hat vor le die Silbe pte mit getilgtem e-Zeichen; 
wahrscheinlich sollte die ganze Silbe getilgt sein. — Statt prdpsya- 
simam hat B anscheinend präpsyasiyarh. — Nach khecarah lässt B 
den Interpunctionsstrich aus. 

V. 37. B lamvanadhritis. — Sitdmsusekharam = candraSekharam, 
d. i. Siva. — B iti statt iha; iti ist wohl aus dem folgenden Halbvers 
hierher gerathen. Vgl. unten das Citat aus dem Kathäsaritsägara zu 
diesem Vers. — B varada statt varadam und dhyäyati statt dhydyantt 
— In dem Worte pdrvatipatim hat B nach der Silbe va einen Strich, 
der wie ein Interpunctionsstrich aussieht und wohl nichts zu bedeuten hat. 



■o 






■o 



<=> o 



(T3 



= 1 

F P. 



u 

«4- ~° 

O <L> 



> cu 

=> O 

— O 

CO 



£ -o 
-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original fronn 



BANAS KÄDAMBARi ETC. 155 

V. 39. B simhävikrama-. Derselbe Name kommt Kath. 117 vor. 

V. 41. B apämsidekhanät. Der Ausdruck ist mit pdriisukrirld 
beinahe identisch. — B vahiscardh statt bahiscardk und maduhkham 
statt madduhkham. 

V. 42. B -duhkhitah statt -duhkhata/i. 

V. 47. B parinayenaivam statt parinaya evam. Vgl. oben V. 11 
vivdhe niyamah kritah. — B maduhkhdn statt madduhkhdn und nd- 
japutroyaih statt rdjaputroyam. 

V. 48. B sa pratijüdm. 

V. 49. B devajayena sd. Statt sd habe ich ca geschrieben. — 
B sakhi statt sakhim. 

V. 51. 'makarikritamdnasd: ihr Herz wurde zu einem makara, 

o 

dem Attribut des Liebesgottes. Ein Wortspiel mit dem Namen Ma- 
karandikä. 

■4-J 

V. 52. B pamcavdnasya statt pancabdnasya. 
V. 53. Statt -pulakotsävah ist vielleicht -pulakodbhavak zu 
schreiben. 

V. 54. B -putra statt -putrah und prdpya statt prdpa. 

£ § 

V. 55. B jyotihprabhasya. S. oben die Anm. zu V. 14. 

V. 56. B marhtrisunund. 

V. 57. B samashydmity statt sameshydmity. — kritammvidam 
adverbiell, wenn nicht kritasarhvidah zu verbessern ist. Das kleine 
Petersburger Wörterbuch hat nur ein Beispiel für samvida Verab- 
redung, Uebereinkunft. Der Instrumental vidyddharendrasutayd ist 
von kritasamvidam abhängig. 

V. 58. Hinter makarandikd hat B offenbar eine Lücke. 

V. 59. B abhavachukah. 

V. 60. Statt des von mir conjicirten virate hat B sinnlos bha- 
vato. Vgl. Kath. 163 ity dkhydya kathdm tatra pidastyo vyaraman 
munih. — datto . tubhyam aharh yayd habe ich statt des handschrift- 
liehen dattd tubhyam iyam maya (!) geschrieben. 

V. 62. B samupeshyati statt samupaishyati. — sarojinydh gc 
hört als Genetiv zu lakshmisutah. Vgl. oben V. 27 sarolakshmih und 
Spejjer, Sanskrit Syntax § 231. — B lakshmtsuta statt -sutah. 

£ "ö 
-ö £ 

E-e 

E =3 

fD O) 

to _c 

! c 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



^ fl) 



w I 

fN CO 

O u 



f 10 - 

O o 

c w 

o 5 



(T3 



$ 5 



156 L. v. MaSkowski. 

V. 63. B jdtismaro statt jdtümaram. 

V. 64. samdkrdntah: ^besucht, heimgesucht/ 

V. 65. B somaprabhopa statt somaprabhopi. 

V. 66. tadviceshtitam hat hier denselben Sinn wie oben V. 64 
tadvrittdntam. 

V. 67. ity evam habe ich statt des handschriftlichen ity eva ge- 
schrieben. Vgl. oben V. 57 ity evam hi kritasamvidanu In ity evam 
schliesst iti das Vorhergehende ab, evam beginnt einen neuen Satz. 

V. 68. B tvam ca tvdm (statt tdm), prdpyasa statt prdpttyasi 
und gauryddühtam statt gauryddishtdm. 

V. 69. B uttamasatvdndm. 

V. 70. B kruldcdravipayarydt (!) statt kuldcdraviparyaydt und 
samgama statt sarhgamah. 

3. Sachliche Anmerkungen zu Kshcmendras Sumana- 

säkhyäyikä. 

V. 1. sa prdha bezieht sich auf Gomukha, der die folgende 
Geschichte dem Prinzen Naravähanadatta erzählt. 

sumdnasah: Kath. 22 heisst der König Sumanas. 

virdjamdndndm: Kath. 23 dkrdntadurgakdntdrabhümind yena 
cakrire \ citrarh virdjamdnena tddfiid api Satravafy. 

Käd. 5 ; 5 ff. dsit . . . rdjd Südrako ndma \ ndmnaiva yo nirbhi- 
nndrdtihridayah . . . ekavikramdkrdntasakalabhuvanatalah . . . jahd- 
seva vdsudevam. 6, 19 ff. tasya ca rdjüali . . . vidiSdbhidhdnä nagarz 
rdjadhdny dsit. 

V. 2. Sabarakanyakd ist gleichbedeutend mit nishddi V. 60 
(vgl. V. 65 nishddabhdvdt). So wechselt auch im Kath. der Ausdruck 
nishdda V. 24 mit bhilla V. 26. Ebenso ist bhilla Kath. 41 gleich- 

r^ -5— 

bedeutend mit pulinda Kath. 43 und iabara Kath. 44 und 45, wo 
auch unser Text die Ausdrücke pulinda (V. 9) und nishdda (V! 10) 
promiscue gebraucht. Hier hat Kath. nishddddhipakanyakd, womit 
man Käd. 12, 15 asmatsvdmiduhitd vergleiche. 

pratihdrena sücitd: ausführlicher Kath. 24 f. Vgl. insbesondere: 
dvdri bahih sthitd . . , devaih didrikshate. 

£ -o 
-ö v 

E-e 



ti öi 



O -ö 
^ fl) 



w I 

fN CO 

f\l ^ 

, O) 

o u 



O o 

c w 
o E 



F P. 



fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Bänas KAdambarI etc. 157 

Käd. 8, 3 ff. ekadd tu . . . rdjdnam dsthdnaman^apagatam . . . 
pratihdri . . . abramt \ deva dvdrasthitd . . . cdnddlakanyakd pa- 
fijarastharh Sukam dddya devam vijüdpayati \ sakalabhuvanatala- 
sarvaratndndm udadhir ivaikabhdjanaih devo vihamgamaS cdyam 
dScaryabhüto nikhilabhuvanatalaratnam iti kfitvd devapddamülam 
dddydgatdham icchdmi devadarsanasukham anubhavitum iti. 

V. 3. marakatacchavim: vgl. Käd. 10, 15 f. antargataSukaprabha* 
sydmdyamdnarh marakatamayam iva paüjaram. 

antah pravishtd: Kath. 26 f. pravUatv iti rdjüokte pratihdrani- 
deSatah . . . pravivesa sd \\ na mdnushzyarh divyastri kdpi nUnam asdv 
iti | sarve 'py acintayams tatra drishtvd tadrüpam adbhutam. 

Käd. 8, 18 ff. rdjd . . . prave&yatdm ity ddideSa \ atha prati- 
hdri tarn mdtahgakumdrim prdveiayat. 10, 11 ff. avanipatis tu . • . 
tum vayahparindmapdndurcLsirasd .. . . purushenddhishthitapurobhdgdm 
. . . paüjaram udvahatd cdnddladdrakendnugamyamdndm . . . dadarSa | 
samupajdtavismayasya cdbhün manasi mahipateh \ aho vidhdtur a- 
sthdne rüpanishpddanaprayatnah u. s. w. 12, 4 ff. rdjdnam . . . ka- 
nyakd pranandma [ . . . sa purushah . . . rdjüe nyavedayad abravic ca. 

V. 4. devayogyah: Kath. 28 f. sukah . . . mayeSvaropayogitvdd 
ihdnito y dya grihyatdm. Tawney (The Kathd Sarit Sdgara, Calcutta, 
1884, ix, S. 19) übersetzt: ,1 have brought him here to-day by the 
order ofking Maya, so receive him', was wenigstens mit unserer 
Lesart sich entschieden nicht verträgt. Vgl. unten das Citat aus Käd. 

vijndnamadhuradhvanih: Kath. 28 f. caturvedadharah sukah\\ 
kavih kritsndsu vidydsu kaldsu ca vieakshanah. 

nidadhe: Der Käfig wird nach Kath. 30 von dem Thorsteh er, 
nach Käd. von einem der Begleiter des Cän<Jälamädchens vor den 
König hingestellt. 

Käd. 12, 7 ff . deva viditasakalctSdstrdrthah . . . veditd gita&ru- 
tinurh kdvyandtakdkhydnakaprabhfitindm . . . adhyetd svayarh ca kartd 
. . . vindvenumurajaprabhritindrh vddyaviseshdndm asamah £ro£au.s.w. 
. . . sakalabhütalaratnabhütoyam vaisampdyano ndma Sukah \ sarva- 






o -ö 
3 * 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



fD 



2 5 



fD 

F P. 



u 

«4- "ö 

O <L> 

CT 



miduhitd devapddamülam dydtd \ tad ayam dtmiyah kriyatdm \ ity 



=) O 

— o 

CO 

ratndndih codadhir iva devo bhdjanam iti kritvainam dddydsmatsvd- 

_^ fD 

ifl tn 

£ -o 
-o v 

E-e 

E => 

fD <D 
in 4-/ 

s_ C 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



158 L. v. Mankowski. 

uktvd narapateh puro nidhdya paüjaram asdv apasasdra (vgl. oben 
das Citat aus Käd. zu V. 2) | apasfite ca tasmin 8a vihamgardjah . . . 
äryäm imärh papdtha. 

Die Strophe, die der Papagei recitirt, lautet nach Kath. 31: 

rdjan yuktam idam sadaiva yad ayam devasya samdhukshyate 
dhüma&ydmamukho dvishadvirahimnih&vdsavdtodgamaih \ 

etat tv adbhutam eva yat paribhavdd bdshpdmbupüraplavair 
dsdm prajvalatiha dikshu dasasu prdjydlj, pratdpdnalali \\ 

Vgl. Käd. 12, 20 f.: 

stanayugam a&rusndtam samipataravarti hfidaya&okdgneh \ 
carati vimuktdhdrarh vratam iva bhavato ripustrindm \\ 

In beiden Strophen ist von Feuer und von den in Thränen 
schwimmenden Witwen der Feinde des Königs die Rede ; sonst haben 
aber dieselben nichts gemeinsam. Dagegen spricht Bäna an einer 
anderen Stelle (Käd. 6, 9 ff.) ebenfalls von dem Feuer des könig- 
lichen Machtglanzes mit Bezug auf die Witwen der Feinde: yasya 
ca (sc. Mdrakasya) hridayasthitdn api patin didhakshur iva pratd- 
pdnalo viyoginzndm api ripusundarindm antarjanitaddho divdnUam 
jajvdla. Der hier ausgesprochene Gedanke erinnert lebhaft an die 
Strophe im Kathäsaritsägara, die wohl sicher das Ursprüngliche be- 
wahrt hat; Bäna aber scheint an beiden Stellen neben der Brihat- 
kathä auch Subandhus Väsavadattä benutzt zu haben, wo es S. 41 f. 
heisst: yasya ca pratdpdnaladagdhdndm ripusundarindm karatala- 
tddanabhitair iva muktdhdraih payodharaparisaro muktdh,. 

Ueber die Verwunderung des Königs und seine Belehrung durch 
den Minister s. Kath. 33 f. tato Hivismite rdjni mantri tasydbravid 
idam \ iaiike sdpdc chukzbhütah pürvarshify ko "py ayam prabho || 
jdtismaro dharmavaädt purddhitam smaraty atah. Vgl. Käd. 12, 22 



ö öi 



o -ö 
3 * 



w i 

fN CO 
f\l ^ 

ct 



o E 



§ s 



F p. 



u 



CT 



rdjd tu tarn Srutvd samjdtavismayah ... 13, 9 ff . kumdrapdlitah (bo 



8arhskdrdnubandhena vd purushaprayatnena vd saihskdrdtUaya upa~ 
jdyata iti ndticitram. 



heisst der Minister) . . . nyipam avddit . . . tatrdpy anyajanmopdtta- 

CO 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bänas Kädambar! etc. 159 

V. 5. kritdhnikah; dies fehlt bei Somadeva, stimmt aber mit 
der Schilderung Käd. 13, 18 — 17, 13 überein: kshitipatir dsthäna- 
mandapdd uttasthau | . . . atha visarjitardjalokah . . . narapatir 
abhyantararh prdvisat \ . . . vydydmabhümim aydsit \ . . . sndnabhü- 
mim agacchat \ . . . devagriham agamat | . . . vilepanabhiimau . . . 
candanendnuliptasarvdngah . . . dhdram . . . avanipo nirvartayd- 
mdsa | . . . parijanendnugamyamdnah . . . dsthdnamandapam aydsit. 

kukam dhüya (dhdrya?): Käd. 17, 17 f. antahpurdd vaUa- 
mpdyanam dddydgaccheti . . . rdjd pratihdrtm ddidesa | . . . atha . . . 
vaikampdyanafy pratihdryd grihitapanjarah . . . rdjdntikam djagdma. 

rahah : ein Zusatz Kshemendras, der dem Kathäsaritsägara und 
der Kädambari fremd ist. 

papraccha: ausführlicher Kath. 34 f. rdjd sa kukam pricchati 
sma tarn || kautukam bhadra me brühi svavfittdntam kva janma te \ 
sukatve kdstravijndnam kutah ko vd bhavdn iti. Vgl. Käd. 18, 11 ff. 
narapatir abravit ] . . . apanayatu nah kutühalam \ dvedayatu bhavdn 
. . . dtmano janma kasmin deie | . . . kd mdtd \ kas te pitd \ katham 
veddndm dgamah \ katham idsträndm paricayah u. s. w. 

V. 6. Srüyatdm adbhutam vibho: vgl. Kath. 36 avdcyam api 
devaitac chrinu und Käd. 18, 17 ff. vaisampdyanas tu . . . sddaram 
abravit \ deva mahatiyam kathd | yadi kautukam dkarnyatdm. 

haimavati: Kath. 37 hat bloss himavannilcate, ohne hier den 
Wald zu erwähnen ; erst V. 43 ist von demselben die Rede (mahd- 
tavi). Dagegen beginnt auch in der Kädambari die Erzählung des 
Papageien mit der Beschreibung eines grossen Waldes: 19, 1 — 20, 
15 asti pürvdparajalanidhiveldvanalagnd . . . vindhydtam ndma. 

V. 7. rohitakatarau : Kath. 37 hat rohinitaruh \ dmndya iva 
digvydpi bhüriidkhdsritadvijah. Nach Böhtlingks Wörterbuch ist 
rohiryitaru ,ein best. Baum'. Unsere Stelle beweist, dass rohini und 
rohitaka identisch sind, also denselben Baum (Andersonia Rohitaka) 



T3 



V öl 



e? -ö 



w I 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 






bezeichnen. 



Sukalakshasamdkraye: Kath. 37 spricht von Vögeln (dvija) 
überhaupt. 



o 

CO 

11** 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



160 L. v. Mankowski. 

pravayasd §ukena: Kath. tasminn ekah Samara sukyd Sukas ta- 
sthau kfitälayah. 

Käd. 23, 10 ff. tasyaivamvidhasya padmasarasah paScime tire 
. . . avasthito mahdh jtrnalj. Sdlmalwfikshah \ tatra ca . . . sukasaku- 
nikuläni prativasanti sma | . . . ekasmiihS ca jirnakotare jdyayd saha 
nivasatah pa&cime vayasi vartamdnasya katham api pitur aham 
evaiko vidhivaMt sünur abhavam. 

V. 8. daivdt möchte ich mit janitoham verbinden wie Kath. 38 
tasmdd esho 'ham utpannas tasydrh dushkarmayogatah. Vgl. oben 
das Citat aus Käd. 

jananthinam: Kath. 39 jdtasyaiva ca me mdtd Sukt sd paiica- 
tdih gatd. 

avardhayata vatsalah: Kath. 39 f. tdtas tu vfiddhah pakshd- 
ntah kshiptvd vardhayati sma mdm | nikatasthasukdnitabhuktasesha- 
phaldni ca \ asnan mahyam ca vitarann atha tatrdsta matpitd. 

Käd. 25, 5 ff. atiprabalayd cdbhibhütd mamaiva jdyamdnasya 
prasavavedanayd janani me lokdntaram agamat \ . . . tdtah sutasne- 
hdd antamigrihya patuprasaram api Sokam ekdki matsarhvardhana- 
para evdbhavat \ atiparinatavayd& ca . . . caücuputena paranidani- 
patitdbhyah sdlivallaribhyas tandulakandn dddydddya tarumülani- 
patitdni Sukakuldvadalitdni phalaSakaldni samdhritya . . . mahyam 
addt | pratidivasam dtmand ca madupabhuktaSesham akarod asanam. 
Vgl. zu dieser Stelle Väsavadattä S. 107: makarandah phalamüldny 
dddya katham katham api tarn abhinanditdhdraparicayam akdrshit 
svayam ca tadupabhuktaSesham aSanam akarot. 

V. 9. hatebha-: s. oben die Anm. zu diesem Verse. 

pulindaih : s. oben die sachliche Anmerkung zu V. 2. 

Zur Sache vgl. Kath. 41 — 44: 

ekadd tatra türydbhidhmdtagöSringanddim \ 
dkhetakdya samagdd bhillasend bhayamkart || 
vitrastakrishnasdrdkshi dhülivydlulitdmSukd \ 
sambhramodvelacamarivisrastakabaribhard * || 






■o 



cn 



<=> o 



(T3 



2 5 



cu 

c 

— o 



vidrutavydkulevdbhüt sahasd sd mahdtam 



£ i 

1 Es ist wohl sarhbhramodvellaccamaA- zu verbessern. 

£ -o 
-ö v 

E-e 

E =3 

fD O) 

1 i Digilized by ^OOglC CORNELL UNIVERSITY 

O Q_ 



Original fronn 



BAnas KAdambar! etc. 161 

pulindavrinde vividhaprdnighdtdya dhdvati || 
kritdntakriditam kritvd dinam dkhetabhümishu \ 
dgdc chabarasainyam tad ättaih, pisitabhdrakaih || 

Käd. 25, 1 7 fF. ekadd tu . . . sarhtrdsitasakalavanacarah . . . 
mrigaydkoldhaladhvanir udacarat. 27, 13 fF. anantaram ca sarabha- 
sam . . . mrigaydsaktasya mahato janasamühasya . . . kshobhitakd- 
nanam koldhalam asfinavam. 28, 9 fF. atha . . . sarvatah pracalitam 
iva tad aranyam abhavat. 29, 8 fF. abhimukham dpatac ca tasmdd 
vanäntardt . . . iabarasainyam adrdksham. 29, 19 fF. madhye ca 
tasydtimahatah sabarasainyasya . . . kaiScit . . . grihitapisitabhdrailf, 
. . . parivritam . . . Sabarasendpatim apaSyam. 

V. 10. jarannishddena : s. oben die Anm. zu V. 2. 

Zur Sache Kath. 45—48: 

ekas tu vriddhasabaras tatrdndsdditdmishah \ 
adrdksMt sa tarum sdyam kshudhitas tum updgamat || 
druhya ca sa tatrd£u sukdn anydihS ca pakshinah \ 
dkfishydkrishya nidebhyo hatvd hatvd bhuvi nyadhdt || 
tathdydntarh ca nikatam yamakimkarasamnibham | 
tarn dfishtvdham bhaydl linah Sanaify pakshdntare pituh \\ 
tdvac cdsmatkuldyam sa prdpydkrishyaiva pdtaki \ 
tdtam me pitfitagrivarh hatvd tarutale 'kshipat \\ 

Käd. 33, 1 fF. ekatamas tu jaracchabarah . . . andsdditaharina- 
piSitah . . . pisitdrthz tasminn eva tarutale muhärtam iva vyala- 
mbata \ . . . sa jirna&abarah . . . vanaspatim d müldd apafyat | . . . 
sa tarn . . pddapam druhya . . . tasya vanaspateh, Sdkhdntarebhyah 
kotarebhyaS ca sukaMvakdn agrahxt \ apagatdsümi ca kritvd kshitdv 
apdtayat. 33, 22 fF. asdv api pdpah . . . prasdrya . . . antakadandd- 
nukdrinam vdmabdhum . . . dkrishya tdtam apagdtasum akarot \ mdm 
tu svalpatvdd bhayasampinditdngatvdt sdvaseshatvdd dyushah katham 






o -ö 
3 * 



w i 

fN CO 

O u 



O o 

c v> 
o E 



F P. 



api pakshasamputdntaragatam ndlakshayat \ uparatam ca tarn ava- 
nitale SithilaHrodharam adhomukham amuncat. 

V. 11. svakarmanah ieshdt patitah parnasarhcaye: Käd. 34, 6 fF. 
aham api . . . nibhritam ankanilinas tenaiva sahdpatam | avati- 

'■5 § 

E-e 

E => 

fD 0) 

1 i Digilized by ^OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



t! öi 



162 L. v. Mankowski. 

shtapunyatayd tu . . . sushkapattrardser upari patitam ätmdnam 
apasyam. 

sndtum prdptena: übereinstimmend mit Käd., nicht aber mit 
Kath. (s. unten). 

Zur Sache Kath. 49—52 : 

aham ca tdtena samarh patitvd tasya pakshateh \ 
nirgatya trinaparndntah sabhayah prdvisaih ianaih || 
athdvatirya bhillo 'sdv agnau bhrishtdn abhakshayat \ 
§ukdn anydn samdddya pdpah pallfah nijdm agdt || 
tatali sdntabhayo duhkhadirghdm nitvd nisdm aham | 
prdtar bhüyishtham udite jagaccakshushi bhdsvani || 
agaccham pakshasarhruddhavasudhah praskhalan muhuh \ 
trishdrtali padmasarasas tiram dsannavartinah || 

Käd. 34, 9 ff. ydvac cdsau tasmdt tarusikhardn ndvatarati td- 
vad aham . . . bhayenaiva kavalam abhibhüy amdnah . . . atimahatas 
tamälavitapino müladesam avisam \ avatirya sa tena samayena kshi- 
titalaviprakirndn samhritya tan chukasUün . . . agacchat \ mdm tu 
labdhajivitdsam . . . balavati pipdsd paravaiam akarot \ anayd ca 
kdlakalayd . . . nishkramya . . . salilasamipam upasartum praya- 
triam akaravam | . . . muhur muhur mukhena patato muhus tiryanni- 
patantam dtmdnam ekayd pakshapdlyd samdhdrayatah . . . saihsa- 
rpato mama samabhün manasi u. s. w.. 

V. 12. mdricandmnd : Kath. 53 tatrdpasyam kfitasnanam 

IS) 

aham tatsaikatasthitam | munim maricinämdnam pürvapuiiyam ivd~ 
tmanah. 

sthdpitah kripaydsrame: Kath. 54 sa mdm drishtvd samdsvdsya 
mukhakshiptodabindubhify | kritvd pattrapufe 'naishid dsramam kfi- 
payd munih. 

Käd. 36, 9 ff. hdritandmd tdpasakumdrakal), . . . tad eva kama- 
lasarah sisndsur updgamat | . . . sa mdm tadavastham dlokya sa- 
mupajdtadayah samipavartinam rishikumdrakam anyatamam abravit 
u. s. w. 38, 5 ff. upasritya ca jalasamipam . . . svayam mdm . . . 
katicit salilabindün apdyayat \ ambhahkshodakritasekam ca . . . na- 

£ -o 
-ö v 

E-e 

E => 

fD 0) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



T3 



03 



2 5 



F P. 



u 

«4- "° 



Bänas KädambarI etc. 163 

UnipaldSasya . . . chdydydm nidhdya samucitam akarot sndnavi- 
dhim | . . . mdm grihitvd tapovandbhimukham §anair agacchat. 

V. 13. Zur Sache Kath. 55—58: 

tatra drishtvd kulapatir mdm pulastyah kildhasat \ 
tendnyamunibhilj. prishto divyadrishtir uvdca sah \\ 
imam sdpasukam drishtvd duhkhena hasitarh mayd | 
vakshydmi caitatsambaddhdm kathdih vo vihitdhnikah || 
jdtim yacchravandd esha prdgvrittam ca smarishyati | 
ity uktvd sa pulastyarshir dhnikdyotthito 'bhavat \\ 
kritdhnikas ca munibhih punar abhyarcito Hra saht \ 
matsambaddhdm kathdm etdm mahdmunir avarnayat \\ 

Kad. 46, 12 ff. bhagavdn jdbdlih . . . mdm atipraSdntayd dri- 
shtyd drishtvd . . . svasyaivdvinayasya phalam anendnubhüyata ity 
avocat (dies stimmt genau mit der Darstellung Kshemendras über- 
ein) | sa hi bhagavdn . . . divyena cakshushd sarvam eva karatala- 
gatam ivajagad avalokayati | . . . yatah sarvaiva tdpasaparishat . . . 
kautühaliny abhavat \ upandthitavati ca tarn bhagavantam \ dvedaya 
prasida bhagavan Mdrisasydvinayasya phalam anendnubhuyate \ kas 
cdyam dsij janmdntare u. s. w. 47, 2 ff. sa mahdmunih pratyavadat | 
. . . apardhnasamaye bhavatdm . . . sarvam dvedayishydmi \ . . . ni- 
yatam ayam apy dtmano janmdntarodantam svapnopalabdham iva 
mayi kathayati sarvam aseshatah smarishyati \ ity abhidadhad evo- 
tthdya saha munibhih sndnddikam ucitam divasavydpdram akarot. 
49, 9 ff . hdritah . . . sarvais taify saha munibhir upasfitya . . . pi- 
taram avocat | . . . dvedyatdm yad anena kritam aparasmin janmani 
koyam abhüd bhavishyati ca | ity evam uktas tu sa mahdmunih . . . 
abravit \ srüyatdm yadi kutühalam. 

V. 14. sobhyadhdt: Kshemendra lässt hier den Pulastya sofort 
die Geschichte des Papageien erzählen, was mit Kath. und Käd. 
nicht übereinstimmt (s. oben). 

bhüpdlamaulildlitasdsanah: vgl. unten das Citat aus Käd. und 
Kath. 59 dratndkaram urvirh yaJjt §asdsorjitaidsanah. 



CÜ 



ö. 2> 



Cl 



i fD 
O o 

c v> 
o E 

^-^ 4-1 

TD ±3 

- "r? 

£ ö. 

P 

U 

O <L> 

*S 

■h! ■— 
'i/i öi 

s_ 

<u 

> <U 

c 

— o 

.E -ö 
-ö £ 

E-e 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



164 L. v. Mankowski. 

Käd. 50, 1 — 52, 10 asti . . . ujjayini ndma nagari. 53, 20 fF. 
tasydm caivamvidhdydm nagarydm . . . rdjd tdrdpido ndmdbhüt. 
54, 15 ff. yam . . . sirobhih . . . bhujabalavijitdh pranemur avanipdh. 

V. 15. Zur Sache Kath. 60 f. 

tasya tivratapastushtagauripativarodbhavah \ 
harshavatyabhidhdndydm putro devydm ajdyata || 
svapne mukhapravishtam yat somam devi dardar&a sd \ 
tena somaprabham ndmnd tarn cakre svasutam nfipah || 

00 

o 

Käd. erwähnt unter vielen anderen Buss- und Andachtswerken 

fN 

der Königin zum Schluss auch die Verehrung Sivas: 64, 3 f. (vild- 
savati) na mahdntam api klesam aßganat. 65, 4 catvareshu sivaba- 

ö 

lim upajahdra. 65, 5 ff . Jcaddcid rdjd . . . svapne . . . vildsavatydh 
. . . dnane sakalakaldparipürnamandalam saiinam pravisantam adrd- 
kshit. 70, 7 f. sakalalokahridaydnandakdrinaih vildsavati sutam asüta 
(vgl. in unserem Text lokalocandnandanirjharah und Kath. 62 tanvd- 
nah prajdndm nayanotsavam). 74, 15 ff. mdtur asya mayd paripü- 
rnamandalaS candrah svapne mukhakamalam dvisan drishta iti . . . 
rdjd svasüno§ candrdpida iti ndma cakdra. 

V. 16. Unser Text ist hier ausserordentlich kurz. S. Kath. 62 f. 

vavfidhe ca sa tanvdnah prajdndm nayanotsavam \ 
rdjaputro ^mfitamayair gunaih somaprabhah kramdt || 
drishtvd bharakshamam süram yuvdnaih prakritipriyam \ 
yauvardjye 'bhyashincat tarn prito jyotishprabhah pitd || 



w i 

fN CO 

fN ^ 

, O) 

° m 



c v> 
o E 



ro 



§ S 



Ueber die Bestellung des Priyarhkara zum Minister und die Be- 
schenkung des Prinzen durch Indra ist Kath. 64 — 68 die Rede. So- 
map rabha bittet den König, ihn zur Weltbesiegung ausrücken zu 
lassen (Kath. 69 — 71), worauf es dann Kath. 72 heisst: tatah pra- 
namya pitaram digjaydya balaih saha \ prdydc chakrahaydrüdhah 



fD 

F P. 



u 

«4- ~° 



Käd. 76, 14 ff. evam tasya sarvavidydparicayam dcaratas ca- 
ndrdpujiasya . . . sakalalokahridaydnandajananas candrodaya iva pra- 
doshasya . . . yauvandrambhah prddurbhavan ramaniyasydpi dvigu- 



subhe somaprabho y hani 

=> o 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

f0 O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Bänas Kädambar! etc. 165 

ndih ramamyatdm puposha. 77, 5 ff. evam ca kramena samdrüdha- 
yauvandrambham parisamäptasakalakaldvijfidnam adhitdieshavidyam 
cävagamya . . . candrdpidiam dnetum rdjd . . . baldhakandmdnam 
dhüya . . . atipraiastehani prdhinot | . . . baldhakas candrdpidam 
• • • vyajijnapat | - . . vrajantu saphalatdm aticiradarSanotkanthitdni 
lokalocandni | . . . indrdyudhandmd turarhgamaJi preshito rnahdrd- 
Jena dvdri tishthati u. s. w. 110, 7 ff. tatah katipayadivasdpagame ca 
rdjd . . . punyehani . . . dnandabdshpajalamiörena . . . vdrind sutam 
abhishisheca. 118, 20 ff. pratyüshe cotthdya . . . pratipraydnakam 
upaciyamdnena sendsamuddyena jarjarayan vasumdhardm . . . prd- 
tishthata (sc. yuvardjah). 

r-{ 

V. 17. saha priyaihkardkhyena mantriputrena: dies ist als selbst- 
verständlich im Kath. und in der Käd. nicht besonders hervorgehoben. 
Von der Freundschaft zwischen dem Prinzen und dem Ministersohn 
Vaisaihpäyana ist Käd. 76, 9 ff . die Rede. 

vijitya prithivim sarvdm: vgl. unten das Citat aus Käd. und 
Kath. 73 f.: 






T3 



O o 



(T3 



jigdya so y Svaratnena tena dikshu maMpatin \ 
djahdra ca ratndni tebhyo durvdravikramah \\ 
ndmitam svadhanus tena vidvishdm ca Sirah samam | 
unnatim taddhanuh prdpa na tu taddvishatdm Sirah || 

prdpa kdnanam: Kath. 75 dgacchan kfitakdryo 'tha himddri- 
nikate pathi \ samnivishtabalaS cakre mfigaydm sa vandntare. 

Käd. 119, 1 ff. (yuvardjah) namayann unnatdn . . . prithivtm 
vicacdra | . . . tatah kramendvajitasakalabhuvanatalah . . . kaddcit 
kaildsasamipacdrindm hemaktitadhdmndyh kirdidnäm suvarnapuraih 
ndma nivdsasthdnam . . . jagrdha \ tatra ca . . . nijabalasya vtird- 
mahetoh katipaydn divasdn atishthat | ekadd tu . . . mfigaydnirgato 

o v 

vicaran kdnanam . . . yadricchayd kimnaramithunam adrdkshit. 

V. 18. kdntam — vilokayan: ein Zusatz, der sich bei Soma- 
deva und Bäna nicht wiederfindet. 

divyaratndmbaravibhilshitam: Kath. 76 daivdt sadratnakhacitam 
tatrdpaSyat sa kimnaram. 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



0} 



ö. ^ 



Cl 



_N 
'-i-j 
'Ol 

> a 

c (5 
ru 



166 L. v. Mankowski. 

V. 19. tarn kautukdd anusaran: Kath. 76 abhyadhdvac ca tarn 
prdptum tena Sdkrena vdjind. Käd. 119, 18 ff. samupajdtakutühalah 
kritagrahandbhildshas tatsamtpam ddardd upasarpitaturamgali . . . 
nijabalasamähdt sudüram anusasära. 

pavanavegena turagena: Kath. 77 sa kimnaro giriguhdm pra- 
viSyddarSanam yayau \ somaprabhas tu tend6vendtidüram aniyata. 

Käd. 119, 22 f. mahdjavatayd turamgamasya . . . tasmdt prade- 
sdt paficadaiayojanamdtram adhvdnam jagdma | tac cdnubadhyamd- 
nam kimnaramiihunäm . . . acalatungasikharam druroha. 

V. 20. Zu amdnushim (,menschenleer') und tryambakdlayam 
vgl. unten das Citat aus Käd. 

Zur Sache Kath. 78—80: 

tdvat prakzrya kdshthdsu prakdSam tigmatejasi \ 
prdpte praticirh kakubham samdhydsamgamakdrinim || 
Srdntah kathamcid dvritya sa dadar&a mahat sarah \ 
tattire tarn niidm netukdmaS cdSvdd avdtarat \\ 
dattvd tfinodakam tasmdy dhritdmbuphalodakaJt \ 
vUrdntaS caikato 'kasmad aifinod gttanilisvanam \\ 



Käd. 120, 3 ff. acalaHkharaprastarapratihatagatiprasaro vidhri- 
taturamgamai candrdpidah . . . samdrüdhaSramasvedaddrdraSartram 

indrdyudham dtmdnam cdvalokya . . . acintayat u. s. w. 121, 7 vyä- 

^" <-> 

vartitaturagas ca punaS cintitavdn u. s. w. 124, 4 f. adfishtäntam . . . 
acchodam ndma saro dfishtavän. 125, 10 ff. turagdd avatatdra \ ava- 

o ^ 

tirya ca vyapanitaparydnam indrdyudham akarot | . . . grihitakati- 
payayavasagrdsam . . . pitasalilam . . . cotthdpya . . . mlilam ava- 
tatdra | tataS ca . . . kfitvd jalamayam dhdram . . . dsvädya mrind- 
laSakaldni . . . sarahsalildd udagdt \ . . . muhürtath viSrdntaS ca ta- 
8ya sarasa uttare tzrapradeie . . . vinätäntrtjhamkdramtiram amd- 
nusham gitasabdam aifinot \ 6rutvd ca kutotra vigatamartyasam- 
pdte pradeie gitadhvaneh saiabhütir iti samupajdtakavtukah . . . 
vilokayan na kimcid dadaria | . . . kutühalavaSdc ca . . . nimittikri- 
tya tarn gitadhvanim abhipratasthe | kramena ca . . . bhagavatah 6ü- 
lapdneh Mnyam siddhdyatanam apaSyat. 



£ -o 
-0 v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bänas KädambarI etc. 167 

V. 21. tatropavinayantim ca: vgl. oben das Citat aus Käd., wo 
ebenfalls von einer vind die Rede ist. 

Zur Sache Kath. 81—84: 

gatvd tadanusdrena kautukän ndtidüratah | 

so y paSyac chivalingdgre gdyantim divyakanyakdm \\ 

keyam adbhutarüpd sydd iti tarn ca savismayam \ 

sdpy uddrdkritim dfishtvd kritvdtithyam avocata \\ 

kas tvam katham imdm bhümim ekah prdpto *si durgamdm \ 

etac chrutvd svavfittdntam uktvd papraccha so y pi tarn || 

tvam me kathaya kdsi tvam vane 'smin kd ca te sthitih | 

iti tarn pfishtavantam ca divyakanyd jagdda sd || 

Käd. 128, 6 ff. praviSyddrdkshtt . . . amalamuktdHldghatitali- 
ngam . . . bhagavantam tryambakam \ tasyd ca dakshindm mürtim 
dsritydbhimukhzm dsindm . . . pratipannapdSupatavratdrh kanyakdm 
dadarSa. 131, 22 ff. tarn eva divyayoshitam . . . nirxLpaydmdsa \ uda- 
pddi cdsya tasyd rüpasampadd . . . dvirbhütavismayasya manasi | . . . 
kd tvam . . . etad endm upasfitya pricchdmi. 132, 16 ff. atha gitdva- 
sdne mükibhütavtnd . . . sd kanyakd . . . candrdpi^am dbabhdshe | 
svdgatam atithaye katham imdm bhümim anuprdpto mahdbhdgah. 
133, 23 ff. kfitdtiihyayd ca tayd . . . kramena paripfishtah . . . dga- 
manam dtmanah sarvam dcacakshe 134, 16 ff. candrdpidah savinayam 
avddit | . . . kathanendtmdnam anugrdhyam icchdmi | . . . katarat . . . 
kulam anugrihitam bhagavatyd janmand \ kimartham vdsmin kusu- 
masukumdre nave vayasi vratagrahanam. 

V. 22. sd prdha: Kath. 85 kautukam cen mahdbhdga tad vacmi 
srinu matkathdm | ity uktvd sd lasadbdshpapürd vaktum pracakrame. 






o -ö 
3 * 



w i 

fN CO 

O u 



o o 

c v> 
o E 



F P. 



_N 
'-I-J 
'Ol 

> <u 

=) O 

— o 

c O 



himaäailendraSikhare kdiicandhvaye: Kath. 86 ist von einer 
Stadt Käncanäbhä die Rede: astzha kdncandbhdkhyam himddri- 

o Qj 

katake puram. Vgl. dagegen unten Käd. 

Käd. 135, 23 ff. sä tu . . . avicchinnabdshpajaladhdrdsamtdndpi 
. . . pratyavddit | . . . yaeZi mahat kutuhalam tat kathaydmi | Sruyatdm. 
137, 3 ff . arishtdyds tu putrah . . . hamso ndma . . . rdjyapadam 
dsdditavdn | . . . tasydpi sa eva girir (d. i. Hemaküta) adhivdsah. 

Wiener Zeitschr. f. d. Kunde d. Morgen!. XVI. Bd. 12 

o c 
E =3 

fD 0) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



168 L. v. Maäkowski. 

V. 23. Zu kdlena yauvanavati und sndtum dgatd vgl. unten 
das Citat aus Käd. 

Zur Sache Kath. 87 tasya hemaprabhddevydm rdjiiafy putrd- 
dhikapriydm | manorathaprabhdm ndma viddhi mdrh tanaydm imdm. 
Von den Ausflügen Manorathaprabhäs mit ihren Freundinnen (sakhi- 
bhih samam) ist Kath. 88 f. die Rede. Dann heisst es V. 90: ekaddham 
iha präptä viharantt sarastate \ muniputrakam adrdksham savaya- 
8yam iha sthitam. 

Käd. 137, 10 ff, tdm ca (d. i. Gauri) . . . hamsah . , . pranayinim 
akarot | . . . tayoä ca . . . aham . . . ekaivdtmajd samutpannd | tdtas 
tv anapatyatayd sutajanmdtiriktena mahotsavena majjanmdbhinandi- 
tavdn | . . . mahdSveteti . . . ndma kritavdn | . . . kramena ca kfitam 
me vapu8hi . . . navayauvanena padam. 138, 13 ff. ekaddham . . . 
idam acchodam Sarah sndtum abhydgamam \ atra ca . . . saha sakhi- 
janena vyacaram. 

V. 24. smardkdram: Käd. 139, 9 ff. ayugmalocanam va&ikartu- 
kdmam kdmam iva saniyamam . . . tdpasakumdrendnugatam . . . 
munikumdrakam apaiyam. 140, 19 ff. tarn tapodhanayuvdnam iksha- 
mdndham acintayam | . . . ayam aparo munimdydmayo makaraketur 
utpdditah. 

pushpdyudhava6ikritd: Käd. 141, 6 ff. iti vicintayantim eva mdm 
. . . rüpaikapakshapäti . . . kusumdyudhah . . . parava&dm akarot. 

Zur Sache s. noch Kath. 91 tadrüpaSobhaydkrishtd dütyevdham 
tarn abhyagdm | so 'pi sakütayd drishtyaivdkarot svdgatam mama. 

Käd. 141, 20 ff. tarn aticiram vyalokayam | utkshipya niyamdneva 



TS 






TS 

Q. 



O o 



(T3 



tatsamipam indriyaih purastdd dkrishyamdneva hfidayena prishthatah 
preryamdneva pushpadhanvand katham api muktaprayatnam apy 



F P. 



dtmdnam adhdrayam. 143, 11 ff. maddarsanapritivistdritasya cottd- 
natdrakasya . . . locanuyugalasya visarpibhir amsusamtdnaih . . . 
arudhyanta daia disah. 

CT «7 

V. 25. padmalekhayd: der Name fehlt im Kathäsaritsägara. 

Zur Sache Kath. 92 tato mamopavishtdydh sakhi jüdtobhaydSayd | 
kas tvam brühi mahdbhdgety apficchat tadvayasyakam. Vgl. in 
unserem Text V. 29 jndtvd smarasamyogam dvayoh. 



=> O 

— o 



03 

.E -ö 
-ö v 

E-e 

E =3 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






Bänas KAdambar! etc. 169 

Käd. 143, 23 f. upasfitya tarn dvitiyam asya sakacaram . . . 
apficcham \ bhagavan kimabhidhdnah Jcasya cdyam tapodhanayuvd. 

V. 26. budhadattdkkyah: der Name fehlt im Kathäsaritsägara. 

munindrah: Käd. 144, 7 mahdmunih. 

vijitendriyah; Kath. 94 brahmacdri. 

Zur Sache Kath. 93 und Käd. 144, 4 ff.: sa tu mdm . . . abravit \ 
... asti . . . mahdmunir divyalokanivdsi Svetalcetur näma. 

V. 27. tarn — vyalokayat: Kath. 94 sa brahmacdri sarasi 
sndtum atra kaddcana \ dgato dadfUe devyd tatkdldgatayd Sriyd. 
Somadeva hat hier atra, da nach ihm (V. 93) Didhitimat in der 
Nähe wohnt, was weder durch unseren Text noch durch die Kä 
dambari bestätigt wird. Andererseits sprechen Kath. und Käd. von 
der Göttin Sri oder Lakshmi schlechthin, während Kshemendra hier 
abweicht. Dass hier nicht etwa der Text verdorben ist, beweist 
sarojinyd lakskmisutah V. 62. 

Zur Sache Kath. 95 sa tarn Sarirendprdpyarh praMntam mana- 
saiva yat \ sakdmd cakame tena putrarh samprdpa mdnasam. 

Käd. 144, 9 ff. sa kaddcit . . . manddkinim avatatdra \ avata- 
rantarh ca . . . devi lakshmir dadar&a | tasyds tu tarn avalokayantydh 
. . . manmathavikritam mana dsit \ dlokanamdtrena ca . . . kritd- 
rthatdsit | . . . kumdrafy samudapddi. 



v E. 

in </» 

° D i 

fN CO 
f\l ^ 
, O) 

° m 

V. 28. Zur Sache Kath. 96—100: 

c w 
o E 



tvaddariandn mamotpannah putro 'yam pratigrihyatdm \ 

iti nitvaiva tajjdtam sd didhitimatah sutam \\ 

bdlakam munaye tasmai samarpya Sris tirodadhe \ 

so "py andydsalabdham tarn putram hfishto 'grahin munih 

raimimdn iti ndmnd ca kritvd samvardhya ca kramdt \ 






u 

«4- ~° 

O <L> 

upaniya samam sarvd vidydh snehdd aiikshayat \\ 

V ? 

> <u 

C CT 

=) o 



tarn raimimantarh jdnitam etarh munikumdrakam \ 
Sriyah sutam mayd sdkam viharantam ihdgatam \\ 
ity uktvd tadvayasyena prishtd tendpi matsakhi \ 
sd sandmdnvayam sarvarh maduktam tarn tad abravit || 



.E -ö 
-ö v 

12* 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



CÜ 






170 L. v. Maäkowski. 

Käd. 144, 17 ff. tatas tarn utsangenddäya sä bhagavan grihdna 
taväyam dtmaja ity uktvd tasmai 4vetaketave dadau \ asäv api bdla- 
janocitdfi sarvdh kriydh kritvd . . . pundarika iti ndma cakre | pra- 
tipdditavratam ca tarn ägfihitasakalavidyäkaläpam akdrshit \ soyam. 
145, 1 ff. adya . . . amaralokdn mayd saha . . . nirgatya . . . nanda- 
nadevatayd . . . abhihitah u. s. w. In der Kädambari fragt Pun<Jarika 
erst später, nachdem Mahäävetä gegangen, ihre Betelträgerin Tara- 
likä: keyarh kanyakd kasya vdpatyam kimabhidhdnd kva gacchati 
(Käd. 148, 18 f.), worauf ihm diese Antwort giebt. 

V. 29. jndtvd smarasarhyogam dvayoh: s. oben die Anmerkung 
zu V. 25. 

Sasilekhayd: der Name fehlt im Kathäsaritsägara. 

Zur Sache Kath. 101—103. 

tato 'nyonydnvayajfiändn nitardm anurdginau \ 
muniputrah sa cäham ca ydvat tatra sthitdv ubhau || 
tdvad etya dvitiyd mdrh svagfihäd avadat sakhi \ 
uttishthdhdrabhümau tväm pitd mugdhe pratikshate || 
tac chrutvd Sighram eshydmity uktvdvasthdpya cdtra tarn \ 
muniputram gatdbhüvarh bhityäharh pitur antikam \\ 

S * 

Käd. 146, 2 ff. chattrag rähini mdm avocat | bhartfiddrike sndtd 

devi | pratydsidati grihagamanakälah | tat kriyatdrh majjanavidhir 

iti | aharh tu . . . tanmukhdt . . . atikricchrena dfishtim dkrishya 

snätum udacalam. 

O ö 

V. 30. Von der Beschreibung des Zustandes der Manoratha- 
prabhä hat Kath. 104 nur kirhcit kritdhdrd. Dagegen ist hier Bä^a 
sehr ausführlich, und einige Einzelheiten in der Kädambari finden 
sich auch in unserem Texte wieder: Käd. 147, 9 ff. utthdya ca . . . 
tarn eva cintayanti svabhavanam ayäsisham. 150, 1 f. madiraye- 
vonmattasya dushtdvesakriyayeva piidcagrahasya doshavikdro- 
pacayah sutardm akriyata smardturasya me manasah. 

V. 31. Vgl. oben in den kritischen Noten die Anmerkung zu 
diesem Verse und Käd. 143, 6 f., wo es von Purujarika heisst: tarn 
api madmkäradar&anäpdhritadhairyam . . . taralatdm anayad ana- 

'■5 § 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



F p. 






o -ö 
3 * 



w i 

fN CO 

f\l ^ 

, 0) 

O o 

c w 

o 5 



F P. 



Bänas KAdambarI etc. 171 

&<jraÄ. 150, 23 f. chattragrdhini samdgatydkathayat | bhartfiddrike tayor 
munikumdrayor anyataro dväri tishthati. 151, 3 ff. aAam to . . . 
kancukinam gaccha praveSyatdm ity ddiSya prdhinavam. 151, 17 
kapinjalah pratyavddit. 152, 14 f. sa kadäcid dhairyaskhalanavi- 
lakshah kimcid anishtam api samdcaret. 153, 5 ff. kusumdyudhena 
samtdpyamdnam . . . mahdbhütddhishthitam iva grahagfihitam ivo- 
nmattam iva . . . tarn aham adrdksham. 156, 5 f. katham apy evam 
evdyatnavidhfitds tishthanty asavah. 156, 19 ff. tat prdnaparirakshanepi 
tdvad asya yatnam dcardmi | itikfitamatir utthdya gatvd . . . mrind- 
likdh samuddhfitya kamalinipalaidni jalalavaldüchitdny dddya . . . 
kumudakuvalayakamaldni gfihitvdgatya tasminn eva latdgxihaHldtale 
äayanam asydkalpayam. 157, 6 ff. evam ca muhur muhur anyad anyan 
nalinadalaiayanam upakalpayatah . . . samabhün me manasi cintd 
u. s. w. Diese Beschreibung scheint Kshemendra vor Augen gehabt 
zu haben, als er den Vers schrieb. 

V. 32. sakhim vis^ijydsau: Kshemendra weicht hier von seiner 
Vorlage ab oder ist wenigstens ungenau. Zwar sagt auch Bäna 
(s. das Citat aus Käd. zu V. 28), dass der Ascetenjüngling selbst der 
Betelträgerin seiner Geliebten einen Brief an letztere übergiebt, 
später aber erscheint auch in der Kädambari genau wie im Kathäsa- 
ritsägara dessen Freund bei der Prinzessin, so dass die erstere 
Episode nur eine Ausschmückung Bänas zu sein scheint (vgl. oben 
die vorhergehende Anmerkung). 

dnito nijam udydnam: dies widerspricht der Darstellung sowohl 
im Kathäsaritsägara als auch in der Kädambari: RaSmimat bez. 
Pu?<Jarika bleibt, wo er war, d. i. am Ufer des Sees (Kath. 108 aham 
ihdgatd und Käd. 152, 21 ff. sarahsamipavartini . . . latdgahane). 



u 

«4- ~° 

O <L> 

*S 

'i/i öi 

> <U 

C CT 

=> O 

— o 

CO 



Zur Sache Kath. 104—107: 



tatra kimcit kfitdhdrd ydvac cdham vinirgatd \ 
tdvad ddyd sakhi sd mdm dgatya soairam abravit \\ 
dgato muniputrasya tasyeha sa sakhd sakhi \ 
8thita§ ca prdnganadvdri satvarai ca mamdvadat || 
manorathaprabhäpdr&vam aham rahnimatddhund \ 



£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



172 L. v. Maäkowski. 

preshito vyomagamantm vidydm dattvaiva paitfikim || 
prdneivarim vind tarn hi rttadanena sa ddrundm \ 
daidm nito na Saknoti prdndn dhdrayitum kshanam \\ 

V. 33. phullalatdgufijanmadhukardkule: vgl. unten die Beschrei- 
bung in der Kädambari. 

Zur Sache Kath. 108 tac chrutvaivdsmi nirgatya tena yuktd- 
grayäyind \ muniputrakamittrena sakhyd cdham ihdgatd. 

Käd. 162, 6 ff. atha ndtidürodgatena . . . candramandalena 
pldvyamdne jyotsnayd bhuvandntardle . . . pratikumudam dbaddha- 
madhukaramandaldsu . . . taralikaydnagamyamdnd . . . tasmdt prd- 
sddaHkhardd avdtaram. 163, 4 ff . madhukarajdlena . . . anubadhya- 
mdnd . . . tatsamtpam udacalam. 

V. 34. hatarh makaraketund: s. unten das Citat aus Käd. 

Zur Sache Kath. 109 prdptd ca tarn ihddrdksham muniputrarh 
vind mayd \ candrodgamenaiva samam Vfittaprdnodgamdn mfitam. 

Käd. 165, 11 ff. indudveshaparivartitadehatayd prishthabhdgani- 
patitair madanadahanavihvalahfidayanyastanakhamayükhacchalena 
cchidritam iva SaSikiranaih (vgl. praudhacandrakarasmerah im vor- 
hergehenden Verse) . . . upapdditdsmaddgamanena pranaydd ivdpa- 
hritaprdnapürnapdtram anangena . . . tatkshanavigatajivitam tarn 
aham . . . mahdbhdgam adrdksham. 

V. 35. Zur Sache Kath. 110 f.: 

tato 'harn tadviyogdrtd nindanti tanum dtmanah \ 
praveshtum aiccham analam grihitvd tatkalevaram || 
tdvad divo 'vatzryaiva tejahpunjdkfitih pumdn \ 
dddya tacchartram tad utpatya gaganarh yayau || 

fD ^ 

Käd. 167, 1 ff. ha ndtha . . . kirn vd mayd vdmayd pdpayd 
ydham adydpi prdnimi . . . ity etdni cdnydni ca vydkroSanti . . . 
vyalapam. 169, 19 ff. tat tad bahu vilapya taralikdm abravam | . . . 
kdshthdny dhyitya viracaya citdm \ anusardmi jiviteSvaram iti \ 



~G 



.c o 



O -ö 
^ fi) 



w I 

fN CO 

f\l ^ 

, O) 

° m 



o E 



(D 



2 5 



> <u 

C öl 

atrdntare jhatiti . . . gagandd avatirya . . . purushah . . . divydkritih 
svacchavdridhavalena dehaprabhdvitdnena kshdlayann iva digantardni 

.c ^ 

.E -ö 
-ö v 

E-e 



. vatee mahdSvete na paritydjyds tvayd prdndh punar api tavd- 



fD a> 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bänas KAdambarI etc. 173 

nena saha bhavishyati samdgama ity evam . . . abhidhdya sahaivdnena 
gaganatalam udapatat. 

V. 36. Zur Sache s. oben Käd. und Kath. 112 f.: 
athdham kevalaivdgnau patitum ydvad udyatd \ 
tdvad uccarati smaivarh gagandd iha bhdrati || 
manorathaprabhe maivam Jcrithd bhüyo bhavishyati \ 
etena muniputrena tava Jcdlena samgamah \\ 

V. 37. Kath. 114 f. etac chrutvd pardvrittya marandt tatprati- 
kshini | sthitdsmihaiva baddhd&d Samkardrcanatatpard || muniputra- 
suhfit so 'pi gato me kvdpy adarSanam. 

Käd. 170, 14 ff. asau (d. i. Kapinjala) tu . . . udatishthat | . . • 
utpatantam tarn evdnusarann antariksham udagdt | . . . sarva eva te 
tdrdganamadhyam aviSan, 171, 13 ff. aham tu . . . notsyishtavati 
jivitam | diayd hi kirn iva na kriyate. 172, 7 f. grihitabrahmacaryd 
devam trailokyandtham andthaSaranam imam Sarandrthini sthdnum 
dSritd. 171, 19 ff. pratidinam arcayanti devam tryambakam asydm 
eva guhdydm taralikayd saha dtrghasokam anubhavanti ciram avasam. 

V. 38. Kath. 115 f. und Käd. 176, 22 f. (candrdpidal m i) punah 
papraccha caindm \ bhagavati sd tava paricdrikd . . . taralikd kva 
gateti. 

V. 39. Kath. 117 und Käd. 177, 1 ff . atha sdkathayat | . . . 
madireti ndmnd . . . kanyakdbhüt \ tasydS cdsau sakalagandharva- 
kulamukutakudmalapithapratishthitacarano devaS citrarathah pdnim 
agrahit. 

V. 40. Kath. 117. tasydnanyasamd cdsti tanayd makarandikd. 
Käd. 177, 6 ff. anyonyapremasamvardhanaparayoS ca tayolj, . . . 
dScaryabhütam . . . duhitriratnam udapddi kddambariti ndmnd. 

V. 41. d pdmsulekhandt u. s. w.: Käd. 177, 9 ff . sd ca me ja- 
nmanah prabhfity ekdsanaSayanapdndSand param premasthdnam akhi- 



TD 



V öl 



Cl 



03 






(T3 



F P. 



u 

«4- ~° 

O <L> 



lavUrambhadhdma dvitiyam iva hfidayam bdlamittram | . . . iUuja- 



C CT 

=> O 

— O 

ft3 



nocitdbhis ca kriddbhir aniyantrananirbharam apanito bdlabhdvah. 
Kath. 118 hat bloss sd me sakhi prdnasamd kanyd maddulikhaduh- 
khitd. 



£ -o 
-ö £ 

E-e 

E =3 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original fronn 



174 L. v. Maäkowski. 

vivdhe niyamah, kritah: Käd. 117, 12 ff. sd cdmunaiva madiyena 
hatavrittdntena samupajdtaSokd niscayam akdrshtt | ndharh kathamcid 
api sa&okdydm mahdivetdydm dtmanah pdnirh grdhayishydmiti. Hier- 
von ist im Kathäsaritsägara erst später die Rede. An dieser Stelle 
(118 f.) heisst es: tayd sakhi preshitdbhüd vdrtdrh jüdtum ihddya 
me || tato mayäpi tatsakhyd samarh sd prahitd nijd \ sakhi tadantikarh 
tena sthitdsmy ekaiva sarhprati. 

V. 42. Käd. 177, 20 ff. sa (d. i. gandharvardjah) . . . balavadu- 
patdpaparavaSah kshanam api na dhfitim alabhata | . . . kshiroda- 
ndmdnarh kancukinarh vatse mahdsvete . . . kddambarim anuneturh 
tvarh saranam iti sarhdUya matsamipam adyaiva pratyüshasi pre- 
shitavdn \ tato mayd . . . kshirodena sdrdham sd taralikd sakhi kd- 
dambari . . . kuru guruvacanam avitatham iti sarhdUya visarjitd. 
Die Darstellung Somadevas siehe in der vorhergehenden Anmerkung. 

V. 43. Zu dieser Stelle vgl. das oben Bd. xv, S. 216 Gesagte. 
Zur Sache Kath. 120 f.: evam vadanti (so ist statt vadantim zu lesen) 
gagandd avatirndrh tadaiva tarn | svasakhim darsaydmdsa tasmai soma- 
prabhdya sd \\ tarn athoktasakhivdrtdrh parnaSayydm akdrayat \ soma- 
prabhasya tadvdhäsydpi ghdsam addpayat. 

V. 44. vidyddharendnugatd: s. oben Bd. xv, S. 216. Zur Sache 
Kath. 122—125: 



.c o 



O -ö 



w l 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



tato nitvd niidrh sarve tatra te prdtar utthitdh \ 
vyomno y vatirnam dadrisur vidyddharam updgatam || 
sa ca vidyddharo devajayo ndma kritdnatify \ 
manorathaprabhdm evam upaviiya jagdda tdm || 
manorathaprabhe rdjd vakti tvdrh simhavikramafy | 
ydvat tava na nishpanno varas tdvan na matsutd || 
vivdham icchati snehdt tvatsakhi makarandikd \ 



(T3 



2 5 



F P. 



u 

«4- "ö 

tad etdrh bodhaydgatya yenodvdhe pravartate 

'(75 öi 
> <u 

C CT 
=) O 

— o 

c O 

fD 



Käd. 178, 9 ff . atrdntare . . . bhagavdn udagdt tdrakdrdjah | 
. , . candrdpidah suptdm dlokya mahdSvetdrh pallavaiayane Sanaih 
Sanaify samupdvisat | . . . nidrdrh yayau \ atha kshindydm kshapdydm 
ushasi . . . taralikd . . . gandharvaddrakena keyürakandmndnuga- 

'■5 § 

E-e 

E => 

fD O) 

■o E 

(U o 



OO 



s S uiym*™ uy ^ CORNELL UNIVERSITY 






gle 



Original from 



Bänas Kädambar! etc. 175 

myamänd pratyushasy eva prddurdsit | dgatya ca . . . kritaprandmd 
savinayam updvisat | . . . pranamya keyvrakopi . . . sildtalam bheje. 
180, 1 ff. atha sd taralikd . . . vyajijnapat \ bhartriddrike drishtd 
Ichalu mayd bhartriddrikd kddambavi sarvatah kusalini. Die Worte 
nodvdham manyate makarandikd werden von Kshemendra, ab- 
weichend von der Darstellung im Kathasaritsägara und in der KA- 
dambari, wo die Botschaft von Devajaya bez. Keyüraka ausgerichtet 
wird, der Padmalekhä in den Mund gelegt. 

V. 45. Kshemendra folgt hier wieder der Kadambari, wo die 
Schlussworte Taralikäs 180, 5 f. lauten: yat tayd . . . pratisamdishtam 
tad, esha tayaiva visarjitah tasyd eva vindvdhakah keyürakah katha- 
yishyati. Dagegen stimmen die Worte unseres Textes ihaivdga- 
myatdm nur mit Kath. 125 tad etdm bodhaydgatya überein; es liegt 
hier mithin wieder eine Vermischung zweier Recensionen vor. 

V. 46. devajayendpi tad evoktd: eine Abweichung Ksheraentlras 
infolge seiner Ungenauigkeit in V. 44 (s. oben). Kad. 180, 7 ff. 
keyürakobravit | . . . yatra ca bhartrivirahavidhurd tivravrataka- 
rshitdhgi priyasalchi mahat krlcchram anubhavati tatrdham ava- 
ganayyaitat katham dtmasukhdrthiiri pdnbh grdhayishydmi. 

vyacintayat: ähnlich Kad. 181, 9 f. mahdsvetd tu tac chrutvd 

O) 

sucirani vicdrya . . . keyürakath prdhinot. 

V. 47 und 48. Diese Ueberlegung Manorathaprabhas fehlt im 
Kathasaritsägara und in der Kadambari, doch macht auch in der 
letzteren Mahäsvetä ihrem Gaste selbst den Vorschlag, ihn mit- 
zunehmen, u. zw. wahrscheinlich in derselben Absicht wie in unserem 
Texte: Kad. 181, 10 ff. gate ca keyürake candrdpidam uvdca \ rdja- 
putra ramaniyo hemakütah \ citrd ca citrarathardjadhdni \ bahuku- 
tiihalah kimpurushavishayah : peSalo gandharvalokah ... ito mayaiva 
saha gatvd hemaküfam atiramaniyatdnldhdnath tatra drishfvd ca 
mannirviSeshdm kddambarim apaniya tasydh kumatimanomohavila- 



T3 



V öl 



■o 



i fD 
O o 



(T3 



= 1 

F P- 



U 

O <L> 



sitam ekam aho visramya, svobhute pratydgamishyasi Vgl. dagegen 

3 o 



Kath. 12Gf.: 

etac chrutvd sakhhnehdt tdtii vidyddharakanyakdm \ 
gantiihi pravylitdni vakti sma rdjd aomaprabho lha sah 



£ -o 

§ ¥ 12** 

o c 
E =3 

fD 0) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original fronn 



176 L. v. Mankowski. 

drashtum vaidyddharam lokam anaghe kautukarh mama \ 
tat tatra naya mdm a&vo dattaghdso "tra tishthatu || 

V. 49. Kath. 128 tac chrutvd sä tathety uktvd vyomnd sadyah 
sakhzyutd \ tena devajayotsahgdropitena samam yayau. 

Käd. 182, 1 ff. ity uktavatim ca candräpidobravit | . . . karta- 
vyeshu yatheshtham asankitayd niyujyatdm \ ity abhidhdya tayd, 
sahaivodacalat. 

V. 50 — 53. Einige Details unseres Textes wiederholen sich in 
der Kädambari. Im Kathäsaritsägara aber (129 — 139) ist der Be- 
such Somaprabhas bei Makarandikä viel ausführlicher geschildert: 

prdptd tatra kfitätithyd makarandikayd tayd \ 
drishtvd somaprabham ko y yam iti svairam ap?iccliyata || 
tayoktatadudantd ca tatah sd makarandikä \ 
somaprabhena tendbhut sadyo "pahfitamdnasd || 
so 'pi tarn manasd prdpya lakshmim rüpavatim iva | 
sa tu kah sukfiti yo "syd varah sydd ity acintayat \\ 
tatah svairam kathdldpe tum äha makarandikdm \ 
manorathaprabhd candi kasmdn nodvdham icchasi || 
tac chrutvd sdpy avocat tarn tvayänaiigikrite vare \ 
katham vivdham iccheyam tvam §arirddhikd hi me \\ 
evam tayd sapranayam makarandikayodite \ 
manorathaprabhävädid vrito mugdhe mayd varah \\ 
tatsamgamapratikshd hi tishthämity udite tayd \ 



~G 



.c o 



O -ö 
^ fi) 



w I 

fN CO 

, O) 

O u 



o o 

c v> 
o E 



(T3 



karomi tarhi tvadvdkyam ity aha makarandikä || 
manorathaprabhd sdtha jndtacittä jagäda tum \ 



F P. 



O <L> 
N 
'-i-J 
'Ol 

> <u 

C CT 
=) O 

— o 

c O 



snkhi somaprabhah prithvim bhrdntvd prdpto 'fit Iris tava \\ 
tad asydtithisatkärah kartavyah sundari tvayd | 
ity äkarnyaiva jagade makarandikayd tayd || 
ä sarirän mayd sarvam idam etasya sdmpratam \ 
arghapätrikritam kdma/h svikarotu yadicchati || 
evam tayokte tatpritim kramäd dvedya tatpituh j 
manorathaprahhä cakre tayor udvähaniscayam || 
E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



BÄNAS KÄDAMBARt ETC. 177 

Käd. 182, 4 ff . kra-menu ca (jatvd hemakütam äsddya . . . ka- 
ny dnt alipur advdram avdpa | . . . kumdrah kumdripurdbhyantararh 
dadarsa. 189, 13 ff. kosau kasya vdpatyam kimabhidhdno vd ... 
iti muhur muhus candrdpidasambaddhdldpam tadrüpavarnanamu- 
kharam keyürakarh pricchantirh kddambarirh dadarsa \ tasya tu 
drishtakddainbarivadanacandralekhdlakshmikasya (vgl. oben V. 48 
etanmukhendum dlokya) . . . ullaldsa hfidayam \ dsic cdsya mdnasi 
u. s. w. 190, 3 ff . tadd tasyd api . . . rilpdtiSayavilokanavismaya- 
smeram . . . cakshus tasmin suciram papdta | . . . drishtvd ca pratha- 
mam romodgamah . . . samuttasthau j atha tasydh kusumdyudha eva 
svedam ajanayat \ . . , ürukampa eva gatim rurodha \ . . . vepa- 
thur eva karatalam akumpayat | . . . tadd ca kddambarim visato 
manmathasydpi manmatha ivdbhüd dvitiyas tayd saha yo vivesa ca- 

o 

ndrdpidahridayam \ kddambari tu . . . mahäSvetdm . . * kanthe ja- 
grdha | mahdsvetd . . . tarn avädit | . . . bhdrate varshe rdjd . . . 
tdrdpido ndma \ tasydyam . . . candrdpi^o näma sünur digvijaya- 
prasangendnugato bhümim imdm u. s. w. 192, 10 ff. kddambari tu . . . 
mahdsvetayd saha paryafike nishasdda \ . * . tvaritaparijano- 
panitena ca salilena kddambari svayam utthdya mahd&vetdyds ca- 
ranau prakshdlyottariydtiisukendpamrijya puriah pary ankam druroha. 
193, 8 ff. tdmbüladdnodyatdm mahdsvetd tum abhdshata \ sakhi kd- 
dambari sampratipannam eva sarvdbhir asmdbhir ayam abhinavd- 
gatas candrdpida drddhaniyah \ tad asmai tdvad diyatdm. 194, 1 ff . 
sd . . . vepathucalitavalaydvalivdcdlena sarhbhdshanam Iva kurvatd 
hastena svedasalilapätapürvakam grihyatdm ayam manmathena datto 
ddsajana ity dtmdnam Iva pratigrdhayanty adya prabhriti bhavato 
haste vartata iti jivitam iva sthdpayanti tdmbülam addt | . . . grihitvd 
cdparam tdmbülam mahdsvetdyai prdyacchat. 196, 6 ff . (mahdsvetd) 
sakhi candrdpidah kvdstdm iti kddambarim apricchat \ asau tu . . . 
avadat \ . . . darsandd drabhya sarirasydpy ayam eva prabhuh kirn 
uta bhavanasya vibhavasya parijanasya vd \ yatrdsmai rocate . . . 
tatrdyam dstdm iti \ tac chrutvd mahdSvetd . . . gandharvardjarh 
drashtum yayau. 



~o 






w i 

fN CO 
f\l ^ 
, O) 

O o 

c ^ 
o E 

^-^ 4-1 

■o -b 
ro 

jc 

i 

*t 

- ~r? 
£ ö- 

P 

U 

O CL) 

■t! ■— 
'ui öi 

^3 ? 
> <u 

c 
ro 

V. 54. Kshemendra kürzt hier seine Vorlage ausserordentlich ab. 

'-o v 

E-e 

E ^ 
res <D 

in 4-/ 

s_ C 

1 S Digilized by L^OOglC CORNELL UNIVERSITY 

a3 ^ 

ü Q_ 



Original fronn 



178 L. v. Mankowski. 

Zur Sache s. Kath. 140 — 14o und die Inhaltsangabe oben Bd. xv, 
8. 226; vgl. auch Käd. 20U, 14 ff. asau (d. i. Mahäsvetä) . . . kddamba- 
rlm abravit , jigamishati khalu kumdrah j prishthato duhkham avidita- 
crittdntam rdjaeakram äste \ api ca yuvayor dürasthitayor api 
sthiteyam idänim . . . pritir ä pralaydt \ atobhyanujänätu bhavatitL 
Zu diesem Verse vgl. Kath. 144 fai?a^ priyamkaro mantri tasya 
somapvabhasya sah j vicinvdnas ca padavhk tatraivdgät sasainikah und 
Käd. 210, 5 ff . (candräpiäalt) hemakutdt pravritto gantum \ gacchatas 
edsya citrarathatanayd . . . sarvdsdnibandhanam dsit (vgl. unten 
V. 56 dayitdm eva dhydyan) . . . kramena ca prdpya mahdsvetd- 
svamam acchodasarastire sautnivishtam indrdyudhakhurapiitdniisdrc- 
uaivdgatam dtmaskandhdvdvam apasyat. 

V. 55. Zur Sache Kath. 145 f.: 
militdya tatas tasmai prahrishto nijamantriye \ 
somaprabhah svavrittdntaut ydvat sarvavt sa samsati || 
tdvat tasydyayau dvtah sighram dgamyatdm iti \ 
lekhe likhitvd samdesam dddya pitur antikdt || 
Käd. 210 ; 14 ff. (candrdpidah) vaisampdyanena . . . sahaivam 
mahdsvetaivam kddambari . . . ity anayaiva kathayd prdyo divasam 
anaishit. 221 ; 12 ff. (candrdpidah) pituh samipdd dgatam . . . die- 
khahdvakam adrdkshit | . . . yuvaräjas tu ... papdtha \ . . . lekha- 
vdcanaviratir eva praydnakdlattbh netavyeti. 

V. 56. mantrisunund samgatah: mit diesen beiden Worten wird 
die Abreise Somaprabhas aus Käncanäbhä und seine Rückkehr nach 
der Einsiedelei abgefertigt. 

dayitdm eva dhydyan: s. oben die Anm. zu V. 54. 

V. 57. Zur Sache Kath. 147 f.: 
tena sainyam samdddya saeivdnumatena sah \ 
pitrdjndm anatikrdmah jagdma nagarath nijavi || 
tdtani drishtvdham eshydmi na cirdd Ity uvdca ca | 
manorathaprabhdvL tarn ca tavi ca devajayai'n vrajan || 

Vgl. auch Käd. 222, 3 ff . (yuvardjah) praydnapataham avddayat \ 
. . . baldhakaputrath meghanddanamdnam ddidesa | . . . niyatam ca 

£ -o 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

c _Q 

ü Q_ 



T3 



Ö. ^ 
t! öl 



^ fl) 



w I 

fN CO 

f\l ^ 

, O) 

i fO 

m - 

o 5 

c w 

o E 



(T3 



= 1 

F P. 



> <u 

=) O 

^ o 



Bänas KädambarI etc. 179 

keyüraka/t . . . etävatim bhiimim ägamishyatiti tanmukhena vijhäpyä 
pranamya devi kädambari | . . . gariyasi guror äjnä prabhavati de- 
hamätrakasya | . . . mä caivaiit mamsthdh yathd jiviin punar devica- 
ranäravindavandanänandam ananubhüya sthäsyati candräpida iti. 
223, 8 f. lekhahdrakam . . . ujjayinimdrgarh pricchan pratasthe. 22 ( J, 14 
ujjayintm äjagäma. 

V. 58. Zur Sache Kath. 14Ö-152: 
so 'tha devajayo gatvä tat sarvath makarandikäm \ 
tathaiväbodhayat tena jajne sä virahäturä || 
nodyäne sä ratirh lebhe na gite na sakhijane \ 
sukänäm api susrdva na vinodavatir girali || 
nähäram api sä bheje kä kathä mandanädike \ 
prayatnair bodhyamändpi pitribhyäm nägrahid dhritim || 
utsrijya bisinipattrasayanam cäcirena sä \ 
unmädiniva babhräma pitror udvegadäyini || 

Von der Verfluchung Makarandikäs und ihrer Verwandlung in 
ein Nishädamädchen ist Kath. 153 — 155 die Rede (s. die Inhaltsangabe 
Bd. xv, S. 227). 

Mit obiger Darstellung im Kathäsaritsägara vergleiche man die 
lange Beschreibung Käd. S. 250 — 256, die Keyüraka in den Mund 
gelegt wird, insbesondere aber 250, 18 ff. yadaiva . . . mayäyam de- 
vasyojjayintgamanavrittänto nivediias tadaiva . . . mahäsvetä . . . 
svam evä§ramapadam äjagäma \ devy api kädambari . . . niväritä- 
seshaparijanapravesd . . . sakalam eva tarn divasam asthät. 251, 18 f. 
iddnim tu mahäntam äyäsam anubhavati tvadarthe kädambari. 253, 
15 ff. parijaneneva ranaranakena madanaparavasä kusumasayanäd 
utthäpyate | paricärikayevärtyä srastängi sameäryate | . . . muhuh 
. . . udyänam äsevate \ muhuh . . . upavanasarojalam avagähate \ ta- 
smäd utthäya tamälavithim upaiti u. s. w. 254, 1 ff. muhurtam visra- 
mya sarhgttakagriham dvisati \ tato madhuramurajaravalayalalitalä- 
syalilayodvejyamänä . . . dhdrägriham abhipatati | . . . bhavanakala- 






o -ö 
3 * 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



F P. 



bhavanaväpicakraväkamithunaih küjitena khedyate | . . . angayasaha- 



=) O 

— o 

CO 

hamsaravam asahamänä prasthitä . , . kshämatäm abhinandati 

_^ fü 

.E -ö 

E-e 

E => 

ft3 <D 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



180 L. V. MA&KOW8KI. 

kdrapikavrindaih kalakalendknlikriyate u. s. w. 255, 3 ff. na vijndyate 
kivt muydhatayd kirn vildsena kirn nnmddena mmgitakamridahya- 
dhvaniteshu kekdmhkayd dhdrdgyihamarakatamanimayüramiikhdni 
sthagayati (es folgen noch andere Beispiele solch wahnsinnigen Ge- 
bahrens). 255, 18 samcaranti nikha nayati. 256 ; 1 f. sikhiiakunta- 
kulakoldhalena tdmyati. 

V. 50. Zur Sache Kath. 15G— 158 (s. oben Bd. xv, S. 227). 

V. 60—62. Kath. 159—162. S. oben Bd. xv, S. 227 f., wo ich in 
der Inhaltsangabe der Darstellung Somadevas folge. Die von Kshe- 
mendra dem Papagei in den Mund gelegte Prophezeiung findet sich 
im Kathäsaritsägara viel passender am Schluss der Erzählung Pula- 
styas. Ausserdem wird da noch nicht verrathen, dass Sumanas Ras- 
mimat sei. Da auch die Kädambari nichts Aehnliches hat (s. unten), 
so sind die Worte unseres Textes munivaras tvam hi lakshmisutah 
ein Zusatz Kshem endras. 

Die weiteren Schicksale des Papageien übergeht unser Text 
mit Stillschweigen. Zur Sache s. Kath. 163 — 166: 

ity dkhydya kathdm tatra ptclastyo vyaraman munili \ 
aham ca jdtim asmdrshavt harshasokapariplatah \\ 
tato yendham abhavam nitas tatkripaydsramam \ 
na maricimunis tatra grihitvd mdm avardhayat \\ 
jdtapakshas ca pakshitvasulabhdc cdpaldd aham \ 
itas tatalt paribhrdmyan vidydscaryarh pradarmyan \\ 
nishddahaste patitah kramdt prdptas tvadantikam \ 
iddnim ca mama kshinam dushkritarh pakshiyonijam || 

Käd. 346, 1 ff. ity evaih [eva im Texte ist ein Druckfehler) ca 
kathayitvd bhagavdn jdbdlih . . . smitarh kritvd . . . sarvdn eva tan 
chrdvakdn avddit | , . . tad yah sa . . . svayaihkritdd evdvinaydd di- 
vyalokatah paribhrasya martyaloke vaisampdyanandmd Sukandsasii- 
nur abhavat sa evaisha punah svayamkritendvinayena kopitasya pi- 
tur dkroSdn mahd£vetdkritdc ca satyddhishthdndd asydm iukajdtaii 



ti öi 



O -ö 
^ fl) 



w I 

fN CO 

, O) 

O u 



O o 

c v> 
o E 



F P. 



u 

O <L> 

N 



> <U 
C CT 
=) O 

— o 

c O 

patitah \ ity evaih vadaty eva bhagavati jdbdlau bdlyepi me supta- 

w tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



prabuddhasyeva pürvajanmdntaropdttdh samastd eva vidyd jihvdgre- 



Original fronn 



Banas KädambarI etc. 181 

bhavan | . . . vijüdnarh ca sarvavastuvishayam smaranam ca sarhvrf- 
ttam, 349, 2 ff. hdritas tu mdm ... . dtmaparnaidldm nztvd Sanaih 
sva£ayanaikade&e sthdpayitvd . . . niryayau. 353, 2 f. evarh cdvahi- 
tacetasd hdritena samvardhyamdnah katipayair eva divasaih samjd- 
tapakshobhavam \ utpannotpatanasdmarthyaS ca cetasy akaravam 
u. s. w. 353, 6 ff. iti niscityaikadd . . . uttardm kakubham griMtvd- 
vaham | . . . baddham dtmdnam . . . apaiyam \ agratai ca . . . pu- 
rusham adräksham. 354, 12 ff. sa mdm uktavdn \ mahdtmann aham 
. . . cdnddlah | . . . tasyds (d. i. mama svdmino duhituh) tvarii kendpi 
durdtmand kathito yathd jdbdler dsrama evamgunavUishto mahdSca- 
ryakdri sukas tishthati. 356, 21 ff. mdm nitvd sa canddlas tadd . . . 
tasyai canddladdrikdyai darsitavdn. 359, 2 e$hd mdm dddya deva- 
pddamülam dydtd. 

V. 63. sa §ukah prdpa nijarh vaidyddharam vapuh: davon ist 
im Kathäsaritsägara keine Rede; es heisst da V. 178 suko 'pi mu- 
ktvaiva sa vaihagim tanwh jagdma dhdma svatapobhir arjitam. In 
der Kädambari (360, 4 ff.) erklärt das Cä^Jälamädchen dem König: 
kddambarilocandnanda candra sarvas tvaydsya durmater dtmanai ca 
pürvajanmavrittdnta\i sruta eva (aus ihrem Munde erfährt also der 
König seine frühere Geburt, s. oben die vorhergehende Anmerkung)! 
. . . Sdpdvasdnasamayo vartate (vgl. oben Kath. 166 iddnhh ca mama 
kshmarh dushkritam) | . . . tad anubhavatdm samprati dvdv api Sa- 
mara eva . . . tanü parityajya yatheshthajanasamdgamasukham. Hier- 
auf geben der König und der Papagei ihr Leben auf, und später 
erscheint der letztere als Puncjarika vor Mahäsveta. Kshemendra 
scheint hier der Kädambari gefolgt zu sein. 

jdtismaravh vidhdyaiva tarn rdjdnam,: Käd. 360, 20 ff. atha rd- 
jnas tadvacanam, dkarnya samsmritajamnuntarasya . . . makaraketur 
agratah paramdstram kddambarhh kritvd jivitdpaharandya . . . a- 
ntard padam cakdra. Das Letztere findet sich an dieser Stelle auch 



t; öi 



o -ö 
3 * 



w i 

fN CO 

O u 



O o 

c v> 
o E 



(T3 



2 5 



F P. 



u 

«4- ~° 



CT 



Kath. 167: iti sadasi kathdm udtrya tasmin vidushi suke virale vi- 



> V 

citravdci \ sapadi sa sumanomahibh^nd dsit pramadatarangitavismi- 

CO 



tdntardtmd (so lese ich mit Peterson ii, 94). Dagegen erinnert sich 
der König an seine frühere Geburt erst später (Kath. 176), nachdem 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

to _c 
in +j 

s_ C 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



182 L. v. Mankowski. Banas KädambarI etc. 

er Manorathaprabhä erblickt: drishtvaiva manoraihaprabhdm smrita- 
svajdtih sumanomahzpatih. 

V. 64—66. Zur Sache Kafh. 168—176 (s. oben Bd. xv, S. 228 f.). 
Vgl. insbesondere Kath. 174 f. somaprabham . . . makarandikd ja- 
grdha kanthe und vidyddharardjaputrim somaprabhah . . . d&lishya 
kriti babhüva mit Käd. 363, 9 ff. kddambari . . . candrdpidam . . . 
kanthe jagrdha und 364, 5 ff. candrdpidas tathd kanthalagndm kdda- 
mbarirn . . . kanthe grihttvd . . . avddzt. 

jfidtvd vidyayd: nach Kath. 171 f. ist es ebenfalls &va, der der 
Manorathaprabhä offenbart: yo raSmimdn munisuto 'bhimato varas 
te jdtah sa samprati punah sumanobhidhdnah \ tat tatra gaccha tarn 
avdpnuhi sa svajdtirh sadyah smarishyati §ubhe tava darianena. 

V. 67. tato mitho nanandus te: Käd. 369, 4 f. paraspardviyo- 
gena sarva eva sarvakdlam sukhdny anubhavantah pardm kotim 
dnan dasyddhyagaman. 

gatvd tuhinabhüdharami anders Kath. 177 tayd ca samgamya 
punah svakdntayd cirotsukah sa prayayau svam dSramam \ yayaa 
sa somaprabhabhüpatU ca tarn priydm samdddya nijdm nijarh pu- 
ram. Kshemendra scheint hier wieder der Kädambari zu folgen, 
wo die Hauptpersonen am Schluss der Erzählung in der Einsiedelei 
Mahäsvetfis (am Kailäsa, also im Himälayagebirge) versammelt er- 
scheinen. 

V. 68. Saktiyasas heisst die Braut Naravähanadattas, eine von 
der Göttin Gauri begünstigte Vidyädharaprinzessin. 

V. 69. Vgl. Kath. 178 itiha dürdntarito "pi dehindrh bhavaty 
ava&yam vihitah samdqamah. 

= i 

— "r? 

£ ö. 

P 

03 ^ 

U 

«4- ~° 

O <L> 

*S 

'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

£ -o 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



t! öi 



^ fi) 



w l 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o 5 



Original fronn 



t! öi 



An z e i ix e n. 



ZMs T.U-venda. Linguistische Studie von Carl Meinitof, Pastor zu 
Zizow. Separatabdruck aus der Zeitschrift der Deutschen Morgen- 
ländischen Gesellschaft, Bd. lv. Leipzig, 1901. 7G S. 8°. 

Diese neue Arbeit des hochverdienten Bantuforschers bietet die 
Einführung in eine der phonetisch interessantesten Bantusprachcn. 
Mir ist bisher noch keine dieser Sprachen begegnet, welche lautlich 
so reichhaltig wäre wie das Venda'. Dadurch ist sie ein besonders 
wichtiges Glied für die Sprachvergleichung, namentlich für etymolo- 
gische Forschung. Denn diese letztere ist zum allergrössten Teile 
vergebliche Mühe, wo der Phonetik nicht die gehörige Sorgfalt ge- 
widmet wird. Da stellt z. B. Seidel in seiner Zeitschrift für afri- 
kanische und ozeanische Sprachen eine Untersuchung an über die 
Wurzel ta und scheint keine Ahnung davon zu haben, dass hierbei 
f, t, t y f, 1 th, th, th, th 1 der verschiedenen Bantusprachen zu unter- 
scheiden und zu berücksichtigen sind, daneben die entsprechenden 
Nuancen von l, r, d, u. s. w. Das Ergebnis der Untersuchung ist 
denn auch natürlich ein ganz verfehltes. 

Phonetik ist's, was man beim Sprachstudium zuerst und vor 
allen Dingen sorgfältig zu treiben hat, sonst wird man nur stümpern, 
wie das u. a. auch die so anspruchsvoll auftretende vergleichende 
Grammatik von Torrend zeigt, die ganz und gar nicht das Lob ver- 

C CT ' 

3 o 

1 Meine Bezeichnung für die betreffenden bisher irrtümlich , Laterale ge- 

<J3 

nannten Laute. 



Q. 



03 



Wiener Zeitschr. f. d. Kunde d. Morgen!. XVI. Bd. 13 

LT) lh 

.E -ö 

T3 £ 

E-e 

E => 

(ü <D 

to _C 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



T3 









w i 

fN CO 

f\l ^ 

° m 



o o 

c v> 
o 5 



F P. 



u 



184 Carl Metnhof. Max Grünert. 

dient, das, in Unkenntnis der Dinge, ihr gespendet wird. — Die 
Phonetik liegt im Allgemeinen noch sehr im Argen; es herrscht in 
dieser Hinsicht in den Bantu-Grammatiken und Wörterbüchern, auch 
bei ^Fachleuten', noch eine heillose Verwirrung und Unklarheit, mit- 
unter über die einfachsten Begriffe. — Will Einer in der Bantuistik 
wirklich einen guten Grund legen, der gehe zunächst bei Meinhof 
in die Schule und studire dessen ,Lautlehre° und die vorliegende 
sich daran anschliessende Venda'- Studie und dann alles, was hoffent 
lieh von Meinhof noch weiter publizirt wird. 

Die Deutsche Morgenländische Gesellschaft verdient aufs neue 
grossen Dank dafür, dass sie für die Veröffentlichung auch der 
Venda- Studie von Meinhof freundlichst die Hand geboten. 

Die Ausstattung des Separatabdruckes ist gefällig, der Druck 
schön und klar. — Ich wünsche dem Werkchen von Herzen geseg- 
neten Erfolg. 

Berlin, Februar 1902. K. Endemann. 



Ihn KutaibcCs Adah al-kätih. Nach mehreren Handschriften heraus- 
gegeben von Max Grünert. (Mit Unterstützung der kaiserlichen 
Akademie der Wissenschaften in Wien.) Leiden. E. J. Brim, 1900. 

8° x + v.rSS. 



Eine europäische, wissenschaftlich instruierte Ausgabe des be- 
rühmten Handbuchs der Stilistik des Encyklopädisten Ibn Qutaibah 
war schon seit vielen Jahrzehnten ein Desideratum derjenigen, die 
sich dem Studium der arabischen Philologie gewidmet haben. Die 
im Jahre 1300 H. in Kairo erschienene Ausgabe hat ja höchstens 
den Wert einer schlechten Handschrift, schon wegen des Mangels 
jedweder Vocalisation, der in einem Werke dieses Charakters doppelt 
unangenehm ist. Denn die eminente Wichtigkeit von Ibn Qutaibah's 

> 0) 
C CT 

=> o 

— o 

CO 

s s 

1 jGrundriss einer Lautlehre der Bantusprachen.' Leipzig 1899. 

£ -o 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Buche beruht vor allem in seiner Brauchbarkeit als Schulbuch, 
worin es z. B. at-Ta'älibi's inhaltlich verwandtes Gompendium (Piqh 



Tbn Kutaiba's Adab al-kätib. 185 

al-lugah) bei weitem übertrifft, während sein sprachwissenschaftlicher 
Wert unbedeutend ist und neben der bezüglichen lexikographischen 
und grammatischen Litteratur ganz verschwindet. Trotzdem spielt 
es in dem philologischen Schrifttum der Araber vermöge seiner über- 
sichtlichen und klaren Disposition und der grossen Belesenheit und 
Sachkenntnis seines Verfassers eine bedeutende Rolle und ist Mittel- 
punkt einer grossen und eingehenden Erklärungs- und Scholien- 
Litteratur geworden. Wenn nun ein Gelehrter von dem Range 
Grünert's sich der durchaus nicht leichten Aufgabe unterzogen hat, 
dieses Werk in einer kritischen Ausgabe der wissenschaftlichen Welt 
und vor Allem den Studierenden zugänglich zu machen, so war die 
Erwartung berechtigt, in dieser Ausgabe über jene litteraturgeschicht- 
liche Bedeutung des Werkes, sowie über die persönlichen und wissen- 
schaftlichen Verhältnisse des Autors des Genaueren belehrt zu werden. 
Leider entspricht das vorliegende Buch dieser Erwartung keines- 
wegs. Grünert's ,Einleitung' ist äusserst wortkarg, ja man muss 
sagen dürftig, was umso mehr zu bedauern ist, als einzelne kurze 
Andeutungen des Herausgebers darauf schliessen lassen, dass er sich 
gerade mit dem, was der Leser besprochen zu finden erwartet, ein- 
gehend beschäftigt hat und wol vertraut ist 1 und nur aus unbegreif- 
licher Zurückhaltung schweigt. Der Hinweis auf die bisher zugäng- 
liche bezügliche Litteratur (Wüstenfeld, Flügel, Brockelmann, S. vii. 
Anm. 1) kann nicht als Ersatz dafür gelten; gerade weil man dort 
eigentlich nichts erfährt, möchte man endlich einmal, und zwar eben 
an dieser Stelle, wirklich etwas erfahren und ist über die Versagung 
dieses Wunsches umsomehr enttäuscht, weil der, der hier zu uns 
sprechen sollte, aber zur Unzeit schweigt, die höchste Verpflichtung 
und die beste Legitimation zu unserer Belehrung besässe. 

Auch noch an einer anderen Stelle der ,Einleitung' vermisst 
man grössere Ausführlichkeit aufs schmerzlichste, nämlich dort, wo 



CÜ 






■o 

Q. 



.TD 






U 

O <L> 

*S 



1 Grünert's Irrtum betreffend lbn Qutaibah's Nisbe ad-Dinawari hat schon 
Reckendorp in seiner Besprechung in der ,0rient. Litteraturzeitung' Jg. iv, 403 bis 

CD 

407 berichtigt. Ich komme im Verlaufe meiner Ausführungen noch wiederholt auf 
diese treffliche Kritik zurück. 

13* 

■ö <y 

E-e 

E => 

fD O) 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



186 Max Grünert. 

Grünert von den Grundlagen seiner Ausgabe spricht. Wenn von 
der Handschrift B nichts weiter gesagt wird, als sie sei ; eine alte, 
treffliche Hs/ ? so nützt das dem Leser gar nichts; dass Grünert's 
Text wesentlich auf ihr beruht, merkt man wohl aus den textkritischen 
Fussnoten, aber eine Darstellung des Verhältnisses der benützten 
Handschriften untereinander vermisst man. Auch eine genauere 
Beschreibung der Codices wäre wünschenswert, wo die betreffenden 
Bibliothekskataloge zu wenig sagen, wie z. B. bei den Hss. A und 
B, über welche de Goeje und Houtsma's Catalogus (auf den Grünert 
übrigens zu verweisen vergessen hat, so dass die Auffindung der 
beiden Codices einige Umstände macht; sie sind dort unter No. xlviii 
und xlix verzeichnet) nur äusserst ärmliche Auskunft gibt. Die ge- 
legentlichen Notizen ,über Lücken, Verhältniss der einzelnen Hss. 
zu einander etc.' in den Anmerkungen zum Texte können für diesen 
Mangel nicht entschädigen. 

Indessen nicht nur durch ihre Knappheit befremdet die Auf- 
zählung der von Grünert benutzten Handschriften; sie tut es noch 
weit mehr, wenn man die Zahl der dort genannten Codices (sechs, 
wovon R sich nur auf die Vorrede bezieht, während G den Com- 
mentar des Jawäliqi enthält, der den Text nur auszugsweise mitteilt) 
mit jener der tatsächlich in Europa zugänglichen Handschriften ver- 
gleicht. Schon de Goeje-Houtsma's Catalogus verzeichnet dreizehn 
Handschriften in verschiedenen Bibliotheken, worunter Grünert's L 

CT 7 

und R nicht vorkommen, so dass er neun Codices anführt, die 
Grünert nicht benutzt hat; dazu kommen noch in Constantinopel 
siebzehn Handschriften des Textes (Catalog € Äsir Efendi i, 741, 742, 
743, 744, in, 274; 'Atif Ef. 1995; Selim aga 890; Köpr. Muhammad 
Pasal201; Aja-Sofiya 3769, 3770; Fätih Sarifi 3658, 3659; Bayezid 
Jämr 2677, 2678; As'ad Ef. 2513. Hämidiyyah Turbisi 1042; Laleli 
Jami r 1465) und zwei des Jawäliqi -Commentars (Yeni Jämi f 958; 
Nur - i -'Otmäniyyah 3954), also wenn ich recht gezählt habe 1 im 

"E B 

c 
ro 









w I 

fN CO 

, O) 

O u 






O E 



F p. 



1 Die oben gegebene Liste beruht nur auf flüchtigen Notizen, die ich mir 
bei gelegentlicher Durchsicht der Kataloge gemacht habe; es kann mir also noch 



— -M 



manches Exemplar entgangen sein. 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Ibn Kutaiba's Adab aL kAtib. 187 

Ganzen achtundzwanzig Handschriften, die Grünert unbeachtet ge- 
lassen hat, gegen sechs von ihm benützte. Will man nun auch an- 
nehmen, dass viele davon keinen besonderen textkritischen Wert be- 
sitzen dürften, so ist es doch kaum denkbar, dass ein solcher nicht 
wenigstens einzelnen aus einer so grossen Zahl innewohnen müsste, 
und es widerspricht aller textkritischen Methode, bei der Heraus- 
gabe eines so viel benutzten und daher vielfach interpolierten und 
sonst verdorbenen Textes sich an einige durch den blossen Zufall 
der leichteren Zugänglichkeit ausgewählte Handschriften zu halten, 
eine fünffach grössere Anzahl davon aber zu ignorieren. Dass das 
auch in unserem concreten Falle zutrifft, beweisen die vielen Ver- 
besserungen, welche Reckendorf in seiner oben angeführten Be- 
sprechung zum Texte liefert und von denen der grösste Teil bei 
vollständiger Benutzung des handschriftlichen Materials sich dem 
Herausgeber gewiss von selbst dargeboten hätte. Ich muss zu meinem 
tiefen Bedauern feststellen, dass hierin der Hauptfehler von Grünert's 
Arbeit liegt. 

Wenn es ihm aber trotz dieses methodischen Mangels gelungen 
ist, einen im Grossen und Ganzen guten und glatten Text herzustellen, 
so ist das ein persönliches Verdienst Grünert's und kein Beweis 
gegen das oben Gesagte. Das Buch wird, namentlich infolge der 
reichlichen Vocalisation, dem Studierenden von grösstem Nutzen sein. 
Doch möchte ich gerade im Hinblick auf dieses eine Kleinigkeit 
berühren, deren Tadel bei einem Schultext nicht kleinlich genannt 
werden kann. Ich meine die leider auch in ausgezeichneten Drucken 
häufig genug zu beobachtende saloppe Behandlung der Meddah- 
Orthographie. Ich weiss ja recht gut, dass man auch in guten Hand- 
schriften *^t> 'V^' **"*» *Ui5, *^L*i o**^**f o^j' *^*i» O^^ u - s * f- 
geschrieben findet; 1 aber solcher unlogischen und inconsequenten 
Schreibungen finden sich ja in den besten Handschriften noch mehr, 



ti öi 



Cl 



.TD 



> I 

£ ö. 

P 

U 

«4- ~° 

O <L> 

: 

fc ■? 

1 Das qur'änische Recitationsmeddah für die überlangen, künstlich gedehnten 
Silben einfach in die gewöhnliche Orthographie herübernehmen zu wollen, wie es 
manche orientalische Autoren tun, verträgt sich nicht mit unserer kritisch genaueren 

Aulfassung. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



188 Max Grünert. Ibn Kutaiba's Adab al-kätib. 

ohne dass sie von unserer besseren Einsicht hingenommen würden ; in 
einem Standardwork der Rechtschreibung darf dann aber auch das 
pleonastische Meddah keine Anwendung finden. Die richtige Meddah- 
schreibung wird ja in Fällen, wie o F ^?' O*^ un( i o £ ^ geradezu 
durch die vom Herausgeber aeeeptierte ^UUC-i etc. unmöglich ge- 
macht. 

Den Mangel eines Wörterverzeichnisses muss ich mit Recken- 
dorf ebenfalls lebhaft beklagen ; er macht sich bei einem Werke, 
dessen Inhalt zum grossen Teile lexicographischer Natur ist, doppelt 
fühlbar. Dagegen kann ich Reckendorfs Ansicht, dass die Edition 
einer Textes -Auswahl der extensiven Herausgabe vorzuziehen ge- 
wesen wäre, nicht beistimmen und zwar in Hinblick auf den Cha- 
rakter des Werkes als eines Handbuches. Vollständigkeit ist hier 
die Hauptsache; die Neuheit und philologische Wichtigkeit des Ge- 
botenen können ohnehin nur geringfügig sein und kommen daher 
fast gar nicht in Betracht. Wohl aber ist gerade in dieser Beziehung 
sehr zu bedauern, dass Grünert den Commentar al-Jawäliqi's nicht 
mit herausgegeben hat, was auf Grund der ganz ausgezeichneten 

Wiener und der beiden Constantinopeler Handschriften (s. o.) nicht 
— ^ 

schwer gewesen wäre und in grammatischer, stilistischer und lexiko- 
graphischer Hinsicht den Wert des Buches um ein namhaftes erhöht 
hätte. Wir hätten dafür gerne auf die splendide Ausstattung, die ja 

an und für sich sehr anzuerkennen ist, wenn sie auch den Preis 
2 et 

wesentlich in die Höhe schraubt, verzichtet. 

Kritisieren ist leichter, als Neues schaffen. Wenn ich daher als 
Reccnsent genötigt war manches zu tadeln, so erfreue ich mich da- 
für als Arabist um so unbefangener an der schönen Gabe, die uns 
Grünert beschert hat. Er verdient unser Aller Dank und Aner- 
kennung; Dank aber gebührt auch der kaiserlichen Akademie der 
Wissenschaften dafür, dass sie durch ihre Unterstützung die Publi- 
cation dieses wichtigen Buches ermöglicht hat. 



■o 

Q- 






U 
O <L> 

*S 

'i/i öi 

> <U 

C CT 

Wien, 29. November 1901. 

K. Geyer. 

Ä O) 

.C ^ 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original fronn 






Eranöahr nach der Geographie des Ps. Moses Xorenac'i. 189 

Eräniahr nach der Geographie des Ps. Moses Xorenac'i. Mit histo- 
risch-kritischem Kommentar und historischen und topographischen 
Excursen von Dr. J. Marquart, Privatdozenten der alten Geschichte 
in Tübingen. 1 Berlin, Weidmann' sehe Buchh. 1901 (Abh. der K. 
Gesellsch. d. W. zu Göttingen. Phih-Hist. Klasse. Neue F. B. in. 
N. 2). 

Der Verfasser des armenischen, dem Moses von Chorene zu- 
geschriebenen, Geschichtwerkes hat auch eine Geographie veröffent- 
licht, die in zwei Recensionen vorliegt, deren eine nur ein ,dürftiger 
und schlechter' Auszug der anderen ist, welche den ursprünglichen 
Text des Werkchens enthält. Dr. Marquart hat daraus in seinem 
Buche die Beschreibung EränSahr's nach beiden Recensionen gegeben 
(S. 8 — 15) mit Uebersetzung und ausfuhrlichem Commentar, und zwar 
S. 16 — 136 des Provinzen Verzeichnisses, S. 137 — 165 der Länder- 
beschreibung nach Ptolemaios. Nach Marquart ist es klar, dass der 
Verfasser nicht nur nestorianische Bischofslisten und eränische Erzäh- 
lungen, namentlich die Geschichte Ardaslr's nach dem Kärnämak 
und den Roman von Bahräm Ööbln, sondern selbst schriftliche Be- 
richte über den grossen Kampf der Araber gegen den Chäqän der 
Türken im J. 119 H. (739 n. Ch.) und byzantinische Nachrichten 
über die Sogdaiten, Hephtaliten, Avaren etc. benutzt hat, also frü- 
hestens gegen das Ende der Omayadenzeit, vermuthlich aber erst 
unter den ersten Abbasiden geschrieben hat. Ein kritischer Com- 
mentar zum Verzeichnis der eränischen Länder war unentbehrlich, 
und weil dazu eine Zusammenstellung und Sichtung alles zugänglichen 
Materials nöthig war, ist dieser Commentar zu einer historisch- 
kritischen Untersuchung über den Umfang des Sasanidenreiches 
während der verschiedenen Phasen seiner Geschichte geworden. In 
einigen Excursen wird dann die staatsrechtliche Stellung gewisser 






o -ö 

3 * 



w i 

fN CO 

° m 



c v> 
o E 



(T3 



F P- 



einer Anzahl wenig bekannter, aber ehemals wichtiger Oertlichkeiten 
und Landschaften behandelt. 



u 

«4- ~° 

O <L> 

wichtiger Grenzprovinzen, so wie die genauere Bestimmung der Lage 

> <u 

C CT 

=> o 

— o 

c O 



1 Jetzt Conservator am ethnographischen Museum zu Leiden. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



190 J. Marqüart. 

Ich stehe nicht an zu erklären, dass dieses Buch von der er- 
staunlichen Gelehrtheit, von der hohen kritischen Begabung und der 
seltenen Combinationsgabe des Herrn Verfassers ein glänzendes 
Zeugniss giebt. Zwar bin ich nicht im Stande alles zu beurtheilen, 
wo ich aber die Untersuchungen Marquart's habe nachprüfen können, 
habe ich in der Regel nur zu loben und zu bewundern gefunden. 
Eben daher will ich das Wenige, das ich zu bemerken habe, nicht 
zurückhalten. 

S. 55, 58. Die Identificirung des chinesischen Polo (alte Aus- 
spräche Pok-lo) mit Balchän am östlichen Ufer des Kaspischen 
Meeres scheint mir bedenklich, da ein Kriegszug von da aus nach 
dem nördlichen Indien schwer anzunehmen ist (vgl. S. 58, 211, 214). 
Nach Marquart's Mittheilungen war es 2100 li von Fo-ti-sa entfernt. 
Von diesem Ort wissen wir aber nichts, als dass er 100 li nördlich 
von Kabul lag (vgl. S. 279). Marqüart schreibt: ,Unter Po-lo kann 
nicht Balx verstanden werden, da dieses im Wei-gu unter dem Namen 
Po-ci vorkommt und nur 13320 li von Tai entfernt war/ Die Ent- 
fernung Fo-ti-§a's von Tai wird auf 13660 li angegeben. Stammen 
all diese Angaben aus derselben Quelle, so dass das li stets den- 
selben Werth hat? Sonst wäre, wenn man unter Fo-ti-§a Badachään, 
unter Po-lo Balch (S. 90 Po-ho, oder genauer Po-ho-lo) verstehen 
dürfte, die Distanz von 2100 li richtig (Masüdl, Tanbih, i*: 20 Tage- 
reisen). Ich muss gestehen, dass ich dies zunächst für wahrscheinlicher 
halte. Man bedenke dabei, dass Tochäristän der eigentliche Sitz der 
Küsän und dass die Frucht des Sieges über die Kidariten in 468 die 
Eroberung Tälakän's war (S. 52, 60, 80, vgl. 214). 

S. 60. Neulich hat Herr Specht den Namen ^>-^aJ auf einer 
hephtalitischen Münze gefunden als Asänhuvär (Extrait du Journ. 
As. y Mai-Juin 1901, p. 11), was die Richtigkeit von Nöldeke's 
Lesung des Namens glänzend bestätigt. 

S. 70 ,der vermehrten Ausgabe des Buches der Eroberungen 
von BaläSuri*. Vermuthlich stützt sich Dr. Marqüart auf Dr. Heer's 
Dissertation ,Die historischen und geographischen Quellen in Jäqüt's 






w i 

fN CO 

O u 



O o 

c v> 
o E 



(T3 



2 5 



03 



fU 



geographischem Wörterbuch^, der hat beweisen wollen, dass Jäqüt 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Eranöahr nach der Geographie des Ps. Moses Xorenac'i. 191 

eine zweite vermehrte Ausgabe des Kitäb al-Fotüh benutzt hat. 
Erstens ist es fraglich, ob ein solches im Fihrist gemeint sei. Nach 
Ibn Öäkir (Leidener HS. 1957, Cat. 2 n, 23) ist, wie ich schon in der 
ZDMG. 38 S. 406 angedeutet habe, das Buch der Eroberungen vom 
Buch der Länder verschieden. Er sagt unter dem J. 279, wo er den 
Tod Balädhori's erwähnt: v_jUS ^i^\ ^\jJ*JI v_>U$ *^J&11 ^ <*J^ 

Jl j^>j\ *>•+* k^AxS £y&\ s^J^S jy^x^J\. Da die Worte Ibn Säkir's 
hauptsächlich mit denen des Fihrist tibereinstimmen, ist es nicht un- 
wahrscheinlich, dass in diesem der Titel o^Jl v-^US ausgefallen ist. 
Zweitens aber, wenn auch Balädhori eine ausfuhrlichere Beschreibung 
der Eroberungen unvollendet nachgelassen haben sollte, hat Dr. Heer 
seine Stellung durchaus nicht bewiesen. Ich will hier darüber nur 
eines sagen: In der Stelle Jäqüt iv, ovo, 2 beziehen sich die Worte 
^gy^UJl **£)} jS> nur auf das vorhergehende ^ c^^*^3 ov*, 22; die 
Worte ov£j 22 — ovo ; l sind an unrichtiger Stelle eingeschoben. Falls 
Balädhorl's Buch der Länder vom Fotülj verschieden war, kann 
daraus die Angabe der Eintheilung Choräsän's stammen. Doch auch 
im Ansäb al-aöräf findet man gelegentlich geographische Mitthei- 
lungen. 

S. 81 und 310. Die Identität vom chinesischen U-na-'o (alte 
Aussprache U-na-kat) mit dem Namen der Citadelle von Zamm ist 
mir zweifelhaft. Tomaschek, Sogdiana 112 (176) sagt, dass es ihm 
nicht gelungen ist Una-'o näher zu bestimmen, nämlich als im chi- 
nesischen Bericht, welcher es 200 li östlich von Mu (Merw) setzt. 
Marquart liest Mok für Mu und hält dies für die chinesische Form 
von Amul, muss nun aber eine im chinesischen Bericht gegebene 
Distanzangabe von 400 li zu 150 li reduciren. Nichts verbürgt uns, dass 
der Name r*^ den wir bei Tabari an der einen Stelle nach allen 

° N 

HSS., in der anderen nach einer, wo die zwei anderen resp. ^^ 
oder ^3b geben, als jS>\* gelesen haben, ein alter Name ist und 



Q. O) 



o -ö 

3 * 



w i 

fN «/) 

f\l ^ 

, O) 

^ U 

O U 



o o 

c v> 
o 2 



2 I 



F P. 



S. 119. Da Arrän den arabischen Schriftstellern sehr gut be- 



0> 
_N 
'-I-J 

"oi 
£ =5 
> <u 

nicht eine verhältnismässig moderne Ableitung von >L> /Wind'. 

fO 

kannt war, kommt es mir einstweilig bedenklich vor, Liran (Lairan) 

E-e 

E => 

ro O) 

to r 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



192 J. Marquart. 

überall in Iran zu ändern. Die überwiegende Mehrheit der oft von 
einander ganz unabhängigen Handschriften hat ein l, und wenn auch 
Arrän im engeren Sinn gemeint sein mag, ist der Name doch viel- 
leicht anderen Ursprungs. Man vergleiche, was Marquart S. 117 
über die albanischen Dialecte mittheilt. Vielleicht ist oW aus olri^ 
entstanden wie fl& aus f^*U 

S. 182. Ich gebe zu, dass Ibn Chord. o£ ? 9 für <Jl ^2 ,dann 
nach' zu lesen ist ^\$ ,und nach', also von Djiruft bis Nähr Solai- 
man: Warum aber Marquart meine Verbesserung des folgenden 
L5 3\^ in ^\ pS erst zurücknimmt S. 182 Z. 3 und Anm. 2 und dann 
selbst die Emendation wieder macht S. 183, 1. Z., ist mir ein Räthsel. 
Die Lage von Nähr (Djowi) Solaimän hatte ich mir auch so gedacht 
wie er. Die Zusammenstellung von o^ A j^ m ^ dem heutigen Dar- 
pahän ist schön. Fraglich ist es aber, ob darum nun auch cJ*t*j> 
gelesen werden müsse und nicht umgekehrt o*-**>^ a ^ s ältere Form 
des Namens zu fassen sei. 

S. 190, Anm. 2. Die Verbesserung *!*& für <^k*^ ist richtig, 
obgleich die drei HSS. (die LANDBERö'sche habe ich auch collatio- 

c o 

nirt) <U»^ haben; allein <J* braucht nicht in <^* umgeändert zu 
werden. 

S. 197, Z. 6 ,über C^o f . Der Text hat v^~o ^ nicht ^, 
und der Context erfordert eine Distanzangabe d. h. «ila*^, wie die 
anderen HSS. haben, obgleich dann diese Tagereisen sehr klein sind. 
Auch bei Ibn Rustah ist £?$$ eine Station zwischen crr und 

S. 220 und Anm. 4. «Jj^ ist Elativ von J^ und synonym 






w i 

fN CO 

O u 



O o 

c v> 
o E 



mit töjJl S. n-, 9. 

F P. 



«4- ~° 

O <L> 

öl 



S. 248 und 37 f. Die Conjectur Marquart's, dass Tab. i, ro^r, 
3 statt *iy>5 zu lesen sei J^»j (S. 38, Anm. 1) oder <*^j (S. 250, 
Z. 8), ist zwar nicht unbedingt noth wendig, da unter Aj$>3 ,und seine 
Angehörigen' (s. das Glossar zu Tab.) auch ^y^j mit inbegriffen 
ist, doch sehr wahrscheinlich. Hierauf stützt sich vornehmlich Mar- 
quart's Aussprache Zambil. Die gewöhnliche Lesart der Araber ist 
Rotbll. Nach Abulfeda, Hist. anteisl. 174 (vgl. Masüdl n, 79 ff.) ist 

.E "ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Eran&ahr nach der Geographie des Ps. Moses Xorenao'i. 193 

dies ein Titel der Fürsten von Sind. So hiess der Vater eines Ueber- 
liefcrers namens JU> (s. Moschtabih r\i } TA unter J-**>, wo auch 
die Aussprache Ratbil überliefert ist, Ibn Hadjar n, on), Da Rotbil 
gewiss kein arabischer Name ist, kann man den Zusammenhang dieses 
Namens mit dem der Fürsten von Sidjistän kaum bezweifeln und 
muss man wohl annehmen, dass die Araber ihn so — sei es auch 
falsch — überliefert haben. Der Name Zanbil (wie Ibn Challikän 
n. 838 Wüstenfeld S. o* schreibt) kommt aber auch vor: man hat 
Abu'l-'Abbäs Ahmed ibn al-IJosain ibn Ahmed ibn Zanbil an-Nahä- 
wandl, der nach Dhahabl im Mlzän ein Zeitgenosse des Däraqotni 
war (vgl. Moschtabih 1. 1.), und der aus der Zeit Amln's und Mamün's 
wohlbekannte Mohammed ibn abl Chälid hatte einen Sohn mit Namen 
Abu Zanbil (Fragm. Hist. zr\ f., JA. vi, rrv). Dieser Name hat aber 
eine Bedeutung {zanbil — zibbil, ein Korb) und braucht nicht vom 
Fürstentitel entlehnt zu sein. In einer Anm. zur Uebersetzung des 
Ibn Chord. S. 29 habe ich dazu noch aus Theophanes die Aussprache 
ZisßYjX citirt, vielleicht mit Unrecht (vgl. Marq. S. 247. Ich kann es 
augenblicklich nicht controliren). Gildemeister, De rebus Indicis, 
S. 5, Anm. 5 giebt noch andere Lesarten, die aber wenig Autorität 
haben. Ich vermuthe, dass der Name mit Zäbul, chin. Tsauli (Marq. 
S. 39, 247 f.) zusammenhängt, da Zäbulistän doch der eigentliche 
Sitz dieses Fürsten war (Tanblh r\s 7 n, Marq. S. 250). In dem 
Falle ist Zambil gewiss die richtige Lesart. Auch der Name des 

V V 

Landes wird auf indischen Münzen neben Gabüla bisweilen Ganbüla 

o 2 

geschrieben (Marq. S. 39). Da der erste Buchstabe des Namens Zä- 






T3 
Q. 



.TD 



(T3 



bulistän von den Arabern oft 3 geschrieben wird, kann am Ende bei 
Tabari ^3} behalten werden. 



F P. 



Marquart thut S. 247 dem Masüdl Unrecht wegen seiner Be- 
hauptung, dass Zambil der Titel der Könige war, die über Bost, 
Ghazna und die anliegenden Länder herrschten. Erstens muss man 
bei der Beurtheilung der Murüdj stets im Auge behalten, dass der 



cn 



Verfasser im Tanblh sagt, er habe sehr vieles in der ersten Aus- 

'(L) «fl 



— -M 

fD 



gäbe, leider der einzigen die zu uns gekommen ist, verbessert, wes- 
wegen er den Leser bittet nur die zweite Ausgabe zu gebrauchen. 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

a3 £ 

C _Q 

ü Q_ 



Original fronn 



194 J. Marquart. 

Zweitens aber, was jene Behauptung betrifft, steht Masüdi darin 
nicht allein. Ibn Ohordädbeh £•, 4 v. u. hat ungefähr dasselbe — 
die Stelle wird von Marquart selbst S. 250 mitgetheilt. Aus der 
auch von Marq. citirten Stelle des Balädhorl, der vom Rotbil von 
Sidjistän spricht, ist dasselbe zu entnehmen. Dann finden wir in 
Wirklichkeit, dass wenigstens in den drei ersten Jahrhunderten der 
Hidjra die Fürsten dieser Länder durchaus Zanbil (Rotbil) genannt 
wurden. Marquart's Zweifel beruht lediglich auf dem Umstände, 
,dass die Chinesen von einem ähnlichen Titel absolut nichts wissen' 
(S. 250). Kennen wir dann die chinesische Litteratur so genau, dass 
wir Recht haben ein argumentum ex silentio mit Bezug auf diese zu 
gebrauchen? (vgl. Marq. S. 51). Und können die Chinesen für diese 
Fürsten nicht einen anderen Titel gehabt haben, wie sie z. B. Baktrien 
Ta Jüeh-öi nannten, obgleich das Volk dieses Namens längst ver- 
schwunden war (Marq. S. 208, 254)? Uebrigens schreibt Marquart 
selbst S. 293, dass an einer Stelle ,Ispahbe§ die persische Uebcr- 
setzung des Titels Zambil ist'. 

Der gewaltthätigen Emendation Marquart's (S. 248) von Tab. i, 
rvo kann ich nicht beistimmen. Die Erzählung Saif's ist, wie ge- 
wöhnlich, nicht frei von Ungenauigkeiten, wie z. B. dass Salm ibn 
Zijäd hier Statthalter von Sidjistän unter Moäwia genannt wird, da 
er in Wirklichkeit erst unter Jazld Statthalter von Choräsän ward 
(Jaqübl, ma ; 16 — n^, 4, Hist. n, r"..f.) 5 doch darum haben wir noch 
nicht das Recht, frei hineinzueorrigiren. Die erste Frage ist, was 
unter seinem Amul zu verstehen ist. Als ich das Argumentum zu Band 5 
von Tabari schrieb, fasste ich es als Kabul, mit Vergleichung von 
rA*r, 15 f. und Balädhorl nv ; 8 f., und obgleich ich mich später in 
den Add. für Marquart's Auffassung, dass Zäbulistän gemeint sei, 
erklärt habe, muss ich jetzt bei meiner ersten Meinung beharren. 
Balädhorl sagt, dass der Käbulääh die muslimische Besatzung von 
Kabul vertrieb und sich der Stadt bemächtigte, genau wie es Saif 
rvo, 9 von Amul sagt. Auch passt die Beschreibung von Ämul 
Z. 6 besser auf Kabul als auf Zäbulistän. Es ist kein Grund Z. 9 die 






u -ö 

3 * 



i 



o E 



(T3 



2 5 



03 



fU 



Lesart des Textes ^^ ^-r^} durch c^A.^ zu ersetzen, wie Marq. 

£ ~o 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



EranSahr nach der Geographie des Ps. Moses Xorenac'i. 195 

S. 248 Anm. 2 will. Möglich ist, dass nach J-<^ ^^ <-^*j ausgefallen 
ist ^-*Xu**J\ ^ (J~«"\) cuLL^. Aus den Worten *UxJ\ jSS folgt, dass 
der Sah sich den Muslimen unterworfen hatte, wie Z. 2 f. erzählt ist, 
und die Veranlassung dazu war, dass er vor Zanbll geflohen war. 
Dass, nachdem der Öäh sich Kabuls bemächtigt hatte, Zanbll sich 
vor ihm fürchtete, ist ganz in der Ordnung. Nur fehlt in der Er- 
zählung die Angabe, dass er nachher den Käbulsäh unter seine Bot- 
mässigkeit gebracht hat. Denn aus Bai. nv ? 13 f. und Tab. Z. 12 ff. 
folgt, dass nicht der Sah, sondern Zanbll der hervorragende Herr- 
scher war, da er für sein Land Sidjistän und für Kabul einen Ver- 
trag schloss. Dass er dazu kein Recht gehabt hätte, wie Marq. 
S. 249 annimmt, ist blosse Hypothese. Ueberhaupt wissen wir wenig 
Bescheid über die Geschichte dieser Länder. Selbst von der grossen 
Calamität des Jahres 70, worüber Arib i£ f. uns eine Mittheilung 
macht, sagen die Historiker kein Wort, es müsste denn die Nieder- 
lage von Jazid ibn Zijäd (Balädh. r«*v ? 1. Z. ff.) gemeint sein. 

S. 254. Marquart meint, dass in ^Sj\j^ kein arabischer Ar- 
tikel steckt. Sollte aber der Name nicht mit dem auf derselben 
Seite erwähnten Darada zusammenhängen? 

Die Untersuchungen Marquart's erstrecken sich über einen 
sehr grossen Ländercomplex und eine lange Zeitperiode. Das Ma- 
terial musste dementsprechend von den verschiedensten Seiten her- 
geholt werden und was Dr. Marquart hierin geleistet hat, ist wirk- 
lich erstaunlieh. Die griechisch-römischen Quellen, die byzantinischen, 
armenischen, syrischen, persischen, arabischen, türkischen, indischen, 
chinesischen Bücher, nebst der auf diese bezüglichen Litteratur, alle 
sind benützt und das nicht oberflächlich, sondern mit kritischer Sorg- 









w i 

fN CO 

O u 



o o 

c v> 
o E 



F P. 



falt. Fast jede Seite seines Buches giebt neue Belehrung oder 
wenigstens Anregung zu neuer Prüfung. Ich will daraus hervor- 
heben, was er S. 26 über Samarän schreibt; seine Zusammenstellung 



der Berichte über die Küsän und die Chioniten S. 50 ff., obgleich 

=> o 

— o 



darin bei der Mangelhaftigkeit der Quellen manches fraglich bleibt; 
besser ist es in dieser Hinsicht mit seinen Ausführungen über die 
Hephtaliten gestellt; die politischen Beziehungen der Perser und 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



196 J. Marquart. EranSahr nach der Geographie etc. 

Araber zu den Kaukasusländern, den Türken und Chazaren S. 95 ff., 
über welche er aber demnächst eine ausführlichere Arbeit unter dem 
Titel ,Die Geschichte und historische Ethnographie des Dagestan' zu 
veröffentlichen verspricht. In diesem Abschnitt ist besonders wichtig 
die Verhandlung über die kaspischen Thoren S. 100 ff. Ansprechend 
ist Marquart's Erklärung des Namens Türän, im Gegensatz zu den 
Ariern S. 155 ff.; sie muss aber noch besser begründet werden, ehe 
sie ,bei dem dem Denken abholden Publicum' Beifall finden kann. 
Namentlich muss es vor allem feststehn, dass die Heimath der Arier 
nach dem Awestä wirklich mit Chwärizm identisch ist, worüber der 
gelehrte Verfasser eine nähere Ausführung verspricht. 

Von den Excursen, die alle ohne Ausnahme sehr wichtig sind, 
hebe ich den hervor, der über Tochäristän handelt. In diesem hat 
Marquart mit Hülfe des Leidener Sinologen Prof. de Groot einen 
sehr ergiebigen Gebrauch von chinesischen Quellen machen können. 
Es herrscht aber in den Berichten über die Bewegungen der Volks- 
Stämme des nordöstlichen Asiens nach Süden und Westen solch eine 
Verwirrung, dass es auch Marquart nicht gelungen ist von der alten 

c o 

Geschichte dieses Landes ein ebenso klares Bild zu entwerfen, als 

_ in 

von der späteren Zeit, wo viel mehr vorgearbeitet ist, z. B. durch 
Tomaschek, und wo die Quellen reichlicher fliessen und genauer sind. 



Q. 

^ fl) 



Das gilt noch mehr von den Untersuchungen über die historische 
Geographie von Sind. Sehr interessant ist die Bestimmung von Qan- 






o o 

c v> 
o E 



dahär-Ghandära. Viel Ansprechendes hat auch die Vergleichung mit 
Huan-cung's Reisebericht. Es gehört aber nicht nur grosser Scharf- 
sinn, doch auch Phantasie dazu, in den chinesischen Namen die ein- 
heimischen wiederzufinden. Marquart hat auch hierin viel Vortreff- 
liches geleistet. Einige seiner Identifikationen tragen jedoch einen 
mehr oder weniger problematischen Charakter, so z. B. alles was 
er mit dem Namen >y=^j^i bei Jaqübi verknüpft. Jedenfalls aber hat 

der Verfasser aus den spärlichen, überall zerstreuten Nachrichten 

1 ct 



(T3 



2 5 



F P. 



u 

«4- ~° 

O <L> 

CT 



ro 
ro ' 



der Araber, der Chinesen und selbst der Inder ein historisches Ganzes 
entworfen, das die Grundlage für weitere Untersuchungen bilden 
muss, wenn einmal neue Quellen mehr Licht geben werden. 

.E -ö 
-ö v 

E-e 

E => 

fö O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 






Q. 



.TU 






(T3 



= 1 

F P. 



T3 



3 O 



E. Schrader. Keilinschriftliche Bibliothek. 197 

Ueberhaupt ist dieses Buch die Arbeit eines bedeutenden For- 
schers. Es ist sehr zu bedauern, dass er sich nicht ganz diesen 
Studien widmen kann. 

Leiden, Januar 1902. M. J. de Goeje. 



Keilinschriftliche Bibliothek } herausgegeben von Eberhard Schrader, 
vi. Band. ^Mythologische, religiöse und verwandte Texte. 1. Teil. 
Assyrisch-babylonische Epen' von P. Jensen, Berlin, Reuther und 
Reichard. 1901. xxn, 589 Seiten. 

Von den von Jensen für die KB. zu bearbeitenden mytholo- 
gischen Texten ist jetzt die erste Hälfte, enthaltend die babylonischen 
Mythen und Epen, erschienen. Es sind im wesentlichen dieselben 
Inschriften, die er schon in seiner Kosmologie behandelt hat. Indes 
sind eine Menge neuer Fragmente seit jener Zeit neu gefunden, dann 
ist hier nicht nur eine Auswahl, sondern das gesamte Material über- 
setzt, und schliesslich sind diese Inschriften so schwierig, dass sie 
mit vollem Rechte in gewissen Zwischenräumen immer von neuem 
durchgearbeitet werden können. Zimmern und Delitzsch hatten zu- 
dem Jensens frühere Arbeiten weitergeführt, und so hatte der letz- 
tere nunmehr Gelegenheit, sich mit diesen auseinanderzusetzen. Aus 
diesen Gründen war es geboten, von der sonst in der KB. beobach- 
teten Sitte, von einem ausführlichen Commentar abzusehen und sich 
auf die zum Verständnis notwendigen Noten zu beschränken, abzu- 
gehen, um die gegebenen Uebersetzungen rechtfertigen zu können. 
Allerdings wird das Buch, das sich doch besonders an weitere Kreise 
richtet, dem general reader eine Menge überflüssigen Materials bringen 
und ihm doppelt so teuer als ohne die Noten, und es wäre zu über- 
legen gewesen, ob der Commentar nicht getrennt hätte veröffent- 



u 



licht werden sollen. Gekürzt hätte sicherlich manches werden 



können. So bringt Jensen häufig von ihm selbstständig Gefundenes, 
was andere schon vor ihm auseinandergesetzt haben, und fügt dann 



nicht rechten, sondern ihm dankbar sein für die Accuratesse und 



hinzu: So auch N. N. etc. Aber wir wollen darum mit dem Autor 

£ -o 
-ö v 

E-e 

E => 
in 4-/ 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



198 Eberhard Schrader. 

Penibilität in der Umschrift und Uebersetzung. Man merkt überall 
die lange und eindringliche Beschäftigung mit den Texten, und 
sympatisch ist auch der ruhige, besonnene Ton in der Behandlung 
strittiger Fragen, den innezuhalten dem temperamentvollen Jensen 
gewiss nicht immer leicht geworden ist. Generell möchte ich noch 
bemerken, dass der Verfasser vielleicht etwas zu häufig Ergänzungen 
vorgenommen hat. Auch wo diese als nicht sicher durch cursiven 
Druck hervorgehoben sind, können sie unerfahrene Gemüter leicht 
verwirren, und nach den Erfahrungen, die man bis jetzt bei Er- 
gänzungen von so schweren Texten gemacht hat, kann man nicht 
vorsichtig genug sein. Ein neugefundenes Fragment macht dann 
viele Combinationen hinfällig. Den Anfang des Gilgamosepos hat 
neuerlich auch Haupt im JAOS xxn, 1 ff. restituiert, und er kommt 
zu ganz andern Resultaten wie Jensen. Wer hat da Recht? Am 
besten ist es da abzuwarten, bis neue Funde neues Licht bringen. 

Ich lasse einige Einzel bemerkungen folgen. 

6, 14 (s. S. 309). Bei der Form uStassä ist eventuell auch an 
rron zu denken; vgl. iätdSü — irtdsü (Nbk. 101, 11). Sonst ist aller- 
dings, soweit ich sehe, u, 1 und n, 2 von mm unbekannt. 

6, 32. Eventuell zu b(p)ukku zu ergänzen (K. 4174 Col. in, 31 ; 
Rm. 340, 7. KB. vi, 118, 9, 22). Es bedeutet etwas aus Rohr Ge- 
machtes, etwa eine Rohrhütte (? Serifa, heute genannt 1 ), wie su- 

o u 

takku, amu. 

6, 70. Die Form iiir von nten ist nicht ohne Analogien. Ueber- 
gänge von Verben vb zu * m b sind auch sonst zu constatieren, ekir 

■(75 fo 

von -ipi, irid neben arid (KB. vi, 416). Auch umgekehrte Fälle 

lassen sich nachweisen. 

f "ä . .~. 



■o 



ö. u 
.c o 



O -ö 
^ fi) 



w I 

fN CO 



1 S. Meissner, Von Babylon nach den Ruinen von Hira und Huamaq. S. 12. 
Der Ausdruck findet sich, wie mir Prof. Nöldeke mitteilt, schon im bab. Talmud. 
Ich benutze diese Gelegenheit, um zwei sinnstörende Druckfehler in dieser kleinen 
Schrift zu berichtigen, welche erst nach der letzten Correctur ohne mein Zuthun 



u 

«4- ~° 

O <L> 

N 



> V 

hineingekommen sind. S. 9, 13 lies: Die Fahrt dauerte ungefähr 3 / 4 Stunde; vgl. 
dazu Layard, Ninive und Batylcn 423, der bei Gegenströmung eine Stunde für die 
Tour brauchte. S. 21, 8 ist aus der bekannten Gedichtart Red de eine unverständ- 
liche Rede geworden. 

'■5 v 

E => 

ro <V 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Keilinschriftliche Bibliothek. 199 

38. Der zweisprachige Schöpfungsmythus ist, wie auch Jensen 
annimmt, sicherlich jung, schon weil Babylon gleich hinter Eridu 
erwähnt wird. 

40, 11. rätu hat sich wahrscheinlich bis heute erhalten. Im 
jetzigen Arabisch bedeutet Wj eine Wasserrinne von der Bewässerungs- 
maschine bis zum Flusse; s. Mitt. des Sem. für Orient Sp. 4, 162. 

62, 7. eteru wird in der Bedeutung ,bezahlen' nur in den 
neubabylonischen Contracten gebraucht, daher hier wohl ,be wahren, 
aufbewahren*. 

62, 10. Vgl. dazu Asarh. Berl. Rs. 57, also hier wohl zinnUütu 
zu lesen. 

68, 10. Zu viussü ist vielleicht an die Gleichung russunu — 
mussü (Suppl. 44) zu erinnern. 

88, 24 f. Es scheint doch, als ob Asüäu-namir ekle Speisen- 
reste essen soll. Darnach müssten dann epinnu und habandt die 
thönernen Abzugscanäle bedeuten, wie sie sich z. B. in Khorsabad 
fs. Perrot- Chipiez, Histoire n, 160) gefunden haben und bis zum 
heutigen Tage in den Städten des Orients bestehen. 

90, 48. Ich glaube, dass ramaku die Bedeutungen des ,ausgies- 
sens' und ,sich waschens' in sich vereinigte, denn jedenfalls wusch 
man sich im alten Orient wie auch heute noch nicht in einer Wasch- 
schüssel, nachdem man sie mit Wasser gefüllt, sondern der Diener 
oder der sich Waschende giesst fortwährend Wasser aus einer Kanne 
auf die Hände, Füsse etc., bis die Reinigung vollendet ist. 

92, 10 ff. Adapa wird hier als Lehrer der Menschheit geschil- 
dert. Er hat also die Stelle des berossischen Oannes inne. Aber 
wie kommt man von Adapa zu Oannes? Hat er vielleicht auch 
den Namen ,Künstler' ummänu, uwwdnu geführt, weil er die Men- 

° N 

sehen alle Kunstfertigkeiten lehrte? 

96, 25. Tammuz und Ningiszida, welche von der Erde ver- 



t! öi 



■o 

Cl 



CD 



Di 



=> o 



schwunden sind und teilweise im Himmel, teilweise in der Unterwelt 



_ 

hausen, erinnern lebhaft an die ebenfalls von der Erde verschwun- 



denen Dioskuren, ,doch auch unter der Erde von Zeus mit Ehre 

Wiener Zeitschrift f. d. Kunde d. Morgenl. XVI. Bd. 14 

o c 
E =3 

ft3 <D 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



Original fronn 



200 Eberhard Schrader. 

begäbet, leben sie jetzt um den andern Tag und jetzo von neuem 
sterben sie hin; doch Ehren gemessen sie gleich den Göttern'. 

112, 33. Das p in Jku ist gesichert durch Reisner, Hymnen 
139, 140 beel i-gi u pal-gi; vgl. auch Craig, Reh Texts. n, 13, 4. 
Vielleicht kann man a^ra; XcYÖfxevov \j±di V^l dazu stellen. 

168, 39. Für pilu = Kalkstein spricht folgende unpublicierte In- 
schrift auf einer 60 : 36 cm. grossen Kalksteinplatte: (m il) Sin-he-erba 
sar kiiSati iar(mdt) Asuv | e-piS sa-lam (il)Asur ildni j rabüti ana-ku 
Sa kisalli Esar-ra \ Pkal ildni ina (aban) pi-li \ pisi te-(?)-Su ad-ki. 

176, 176. Zu allil, alla vgl. noch K. 233, 27 (Winckler, Keil- 
sehr, n, 10); K. 1374 Rs. 12 (ib. 21); K. 4287 Rs. 11 (ib. 34), 

176, 179. Zu Saldhu vgl. auch K. 1220 Rs. 1 (Harper, iMt. 
271) ni-iS-lah-su-nu. 

190, 47. Für BSlit-seri s. a. WZKM. 12, 64. 

206, 43. Es ist schade, dass Col. iv so schlecht erhalten ist. 
Das ,Thor der Länder' erinnert an die aus späteren Autoren be- 
kannten Thore, durch welche öog und Magog hereinbrechen wollen. 

210. Zur zehnten Tafel des Gilgamosepos existiert ein Parallel- 
text aus der Zeit der ersten babylonischen Dynastie (noch unpubl.). 
Erhalten ist das untere Drittel der viercolumnigen Tafel, sodass also 
von der ersten und zweiten Columne der untere, von der dritten 
und vierten Columne der obere Teil vorliegt. Die Redaction ist 

o u 

eine andere als die uns aus Asurbanipals Bibliothek erhaltene, aber 
einige Phrasen können doch danach ergänzt werden. In Col. i wird 
die Begegnung Gilgamos (AN-GIS) mit dem Sonnengotte erzählt, 
der ihm auch keine Hoffnung auf Erlangung des ewigen Lebens 



T3 






O -ö 
^ fl) 



o o 

c v> 
o E 



(T3 



2 5 



iE ^ 

macht. In Col. n — in trifft unser Held die Sabitu und berichtet ihr: 



F P. 



_N 
'-I-J 
'Ol 

fc =9 
> <u 

=) O 

— o 

c O 

fD 



(il) EN-KLSAR Sa a-ra-am-mu-ma da-an-ni-is it-ti-ia it-ta-ahla-ktt 
ka-lu mar-sa-a-tim il-li-ik-ma a-na Si-ma-ti a-pi-lu-tim ur-ri u mu-Si 
e-li-Su ab-ki u-ul ad-di-iS-Su a-na ki-bi-ri-im = Ea-bani (?), den ich 
sehr liebte und der mit mir alle Gefahren durchgemacht hat, ist den 
Weg alles Fleisches gegangen. Tag und Nacht weinte ich über ihn und 
gab ihn nicht zum Begräbnis. In der Folge giebt Sabitu ihm den Rat, 
sich hier auf Erden zu amüsieren und nicht an den Tod zu denken 

'■5 v 

E-e 

E => 

fD O) 

- "I n -, li7ö , hu ( Original frorn 

| S Digmzed Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



0} 






T3 
Q. 






Keilinschriftliche Bibliothek. 201 

(s. ZA. 14, 416). In der vierten Columne wird das Zusammentreffen 
des Gilgamos mit Su-ur-su-na-bu berichtet. Dieser Sursunabu ist jeden- 
falls gleich UR-NIMIN zu setzen. NIMIN ist = sanabi = sunabu; 
aber wie UR zur Aussprache sur kommt, ist vorläufig noch nicht klar. 

222, 10. Zum Stamme pon vgl. Pinches, Bab. Tabl. n, 22, 4 ff. •' 
u */ 3 ma-na TA-A-AN hi-im-sa-ta-su-nu a-na bit (il) SamaS E-ri-ib- 
(il) Sin märe Ur-ra-ga-mil märe Ur-ra-ga-mil u DAM-A-NI Ur-ra- 
ga-mil i-ru-bu-u-ma. 

232, 61. Zu ritgubu s. ZA. 14, 419. 

268, 5. Die Schreibzeuge wurden, wie noch heute im Orient, 
in den Gürtel gesteckt. 

282, 12. Vielleicht ist die d(t)iu Krankheit mit einer Krankheit 
zu identificieren, die man im heutigen Iraq abü demre d. i. Vater des 
Gehirns nennt. Sie wird immer als ,Kopfkrankheit' bezeichnet. Be- 
gleiterscheinungen sind Röte des Kopfes, hohes Fieber und Unruhe. 
Die Krankheit ist ansteckend und die Sterblichkeit soll eine grosse 
sein. Ich selbst habe keinen Fall erlebt, aber man hört häufig den 
Fluch: mal abü demre = mögest du der Kopfkrankheit verfallen. Be- 
steht eine Beziehung zwischen dieser Krankheit und dem Dengue- 
fieber (v. Oepele in Orient. Lit. 2, 92)? 

405. Dass usurtu von nar herkommt und rdtä Lehnwort im 
Aram. sei, halte ich für richtig. Ich habe diese Ansicht auch im 



Colleg geäussert. 



426. Jensens Vermutung, dass Nbk. i, 67 tuitepiru für tnSteb- 
biru zu lesen sei, wird bestätigt durch ein bei den Ausgrabungen 
in Babylon gefundenes Duplikat, das tu-us-te-pi-ru bietet. 

463. Mir erscheint die zweite Deutung von pdtiS apsl als die 
allein richtige. 

572. Jensens Bemerkungen über mallatu und itkurtu sind 
jedenfalls richtig. Auch heute wird ein Tisch gebildet, indem man 
ein grosses rundes Tablet auf ein hölzernes Untergestell setzt. 

582, 14. Ist bei ebidti nicht besser an nise apäti zu denken? 

Nochmals vielen Dank für die schöne Gabe. 

Berlin, im Januar 1902. Bruno Meissner. 



w tn 
£ -o 

14* 

o c 
E =3 

fD 0) 

in -m 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Kleine Mittheihmgen. 



TD 






^ fi) 



w i 

fN CO 

f\l ^ 

, 0) 

O o 

c v> 

o 5 



(T3 



$ 5 



F P. 



/*£ das Nitisataka von Bhartyhari verfasst? — R. Schmidts 
Uebersetzung des ,textus ornatior' des Pancatantra giebt auf S. 9 
als i, 12, 13, 14 drei Strophen wieder, von denen die mittlere in der 
guten Hs. A (Koseg.) sowie in der ältesten aller vorhandenen Panca- 
tantra-Handschriften (Bhandarkar, Catal. Decc. College x, 190; datiert 
saijivat 1442) 1 fehlt. Schmidt hat sie nach K und einem Nachtrag 
am Rande in A gegeben. Höchst wahrscheinlich war sie dem ur- 
sprünglichen Texte des ,Ornatior' fremd. 

Strophe i, 12 lautet im Original: 



Strophe i, 14: 



u 

O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



1 Ein Teil des Anfanges dieser Hs. ist nach einem Ms. des t. simplicior er- 
gänzt. Aber die obige Stelle ist in der Fassung des Ornatior erhalten. 



Original fronn 



Kleine Mittheilungen. 203 

Dieselben Strophen finden sich als i 9 8 f. 1 und i, 10 hinter ein- 
ander im südliehen Pancatantra, dementsprechend als h, 36 und n, 37 
ed. Pet. = ii, 39 und n, 40 ed. Schlegel im Hitopadesa. Die alte 
syrische Uebersetzung hat sie gleichfalls unmittelbar hinter einander 
(p. 3, 41 und p. 4, 4 des deutschen Textes). Sie lauten: 

,Ein niedrig gesinnter Mensch hält selbst das Geringste fort- 
während fest, wie ein Hund, der einen ausgedörrten Knochen ge- 
funden hat und sich darüber freut in seiner gemeinen Gesinnung, 
obgleich er keine Erquickung davon hat. Aber ein Strebsamer, der 
nach etwas Besserem verlangt, gibt sich nur durch Nothwendigkeit 
gezwungen zu-[p. 4]frieden; sonst strebt er mit Recht nach immer 
grösserem Reichthum, gleich dem Löwen, der einen Hasen gefangen 
hat und einen Waldesel erblickt, worauf er den Hasen laufen lässt 
in der Hoffnung auf den Waldesel/ 

,Der Hund wedelt lange bettelnd mit dem Schweif, aber der 
wüthende Elefant kennt seine Stärke und Kraft; und wenn man ihm 
auch unter Schmeicheleien Nahrung reicht, so verschüttet er viel 
davon, noch bevor er frisst.* 

Das sind zweifelsohne unsere beiden Strophen. Dass sie nicht 
völlig den Sinn des Originals wiedergeben, darf uns nicht wundern 
bei einer Uebersetzung einer Uebersetzung. Schon der PahlavI- 
Uebersetzer hat die beiden Tiernamen der ersten Strophe offenbar 
nicht verstanden. Der Schakal tritt bei Wolff S. 9, Johann von 
Capua (ed. Derenbourg) S. 41, 5 und in der jüngeren syr. Ueber- 
setzung (Keith-Falconer, Kalllah and Dimnah, S. 5) als Hase auf, 
während f^f, wie es scheint, in das Pahlavi- Original in seiner San- 
skyt-Form herübergenommen wurde. Dem /Waldesel' der alten syr. 






o -ö 
3 * 



w i 

fN CO 

O u 



o o 

c v> 
o E 



F P. 



Uebersetzung entspricht bei Wolff p. 10 ein Kameel, bei Keith- 
Falconer ,a sheep or goat'. Bei Johann von Capua p. 41 lautet der 

° N 

Satz: ,Qui cum predatus est leporem, vidensque quid melius seu 
maius, leporem dimittit, illudque melius perpetrare sollicitat.' Wir 



_N 
'-I-J 
'Ol 

> <u 

C Ol 



werden also sicher im Originale der Pahlavi-Uebersetzung die beiden 
1 Haberlandt bezeichnet die erste versehentlich als zwei Strophen! 



£ -o 
-ö v 

E-e 

E => 

fü 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



0} 



ö. ^ 



^ fi) 



w I 

fN U) 

f\l ^ 

, O) 

O o 

c w 

o E 



(T3 



$ 5 



F P. 



204 Kleine Mitthbilungen. 

Strophen in der Form voraussetzen dürfen, wie sie uns im textus 
ornatior und in der südlichen Recension des Pancatantra vorliegt. 
Aber schon Gunäcjhya hat in seinem Pancatantra-Texte die 
erste unserer beiden Strophen vorgefunden. In Somadevas Ueber- 
setzung lautet sie: 

ftw*r ra ii 3%rt ff *rac *reTsfa qi**fir i 

Wir dürfen also mit Sicherheit behaupten, dass die erste unserer 
beiden Strophen etwa zu Beginn unserer Zeitrechnung, die zweite 
vor Ablauf des 6. Jahrhunderts zum Texte des Pancatantra gehörte. 1 

Ebenso sicher lässt sich behaupten, dass diese beiden Strophen 
zum Urtexte des NltUataka gehören. Nach den Angaben von 
Bohlens in seiner Ausgabe, A. Webers in seinen Varr. lectiones ad 
Bohlenii ed. Bhartrih. sent. pert. (Berol. 1850), nach den Ausgaben 
von Telang, K^snaöästri Mahäbala und nach der Uebersetzung von 
Galanos ist der Befund der folgende: 



Telang Krsnasästri 


Galanos Roger 


v. Bohlens A 


30 30 


30 22 


23 


31 31 


31 23 


26 


von Bohlens Hss. A 


B Webers Hs. B 


Ed. Seramp 


30 


32 33 


33 


33 


70 68 


70 



Wir finden also in 4 von diesen 9 2 Texten die beiden frag- 
lichen Strophen in genau derselben Ordnung wie im Pancatantra, in 
zweien 3 in annähernd derselben Reihenfolge, in den anderen von 
einander weit getrennt. Nur in dem TAYLOR'schen Manuskript, über 



u 

1 Dass beide Strophen im sog. textus simplicior (Kielhorns Ausgabe und 

Hamburger Hss.) fehlen, fällt nicht ins Gewicht, weil der textus simplicior eine 
Ueberarbeitung ist. Vgl. meine Ausführungen ZDMG. lvi, Heft. 2. Eine ein- 
gehende Analyse denke ich zu geben, sobald ich das gesammte mir zugängliche 
handschriftliche Material verarbeitet habe. 

2 resp. 8, wenn wir von Bohlens Ausgabe ausschliessen. 

3 oder einem, da von Bohlen hier = Hs. A. 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Kleine Mittheilungen. 205 

das v. Bohlen S. xi seiner Ausgabe berichtet, fehlt die zweite Strophe. 
Dies fällt aber bei der Beschaffenheit dieser Handschrift nicht ins 
Gewicht, von der von Bohlen sagt: ,Integra quidem Sataca continet 
apographum sed misere vexata et versionis tantum in gratiam, ut 
videtur, subiecta; haec autem versio .... dialecto quadam hodierna 

confecta est Ordo denique versuum in Cod. quam maxime 

est turbatus, ideo ut inutilem fere laborem instituat qui apographum 
hocce cum aliis velit conferre.' 

Aus Vorstehendem ergiebt sich : 

1. dass der Verfasser des NltUataka zwei Strophen in der- 
selben Reihenfolge aus dem Paiicatantra entlehnt hat; 

2. dass bezüglich der Anordnung Telang, K$sna6ästri Mahä- 
bala, Galanos, Roger und Hs. A (von Bohlens Ausg.) ursprünglicher 
sind, als die Serampurer Ausgabe, Bohlens Hs. B und Webers Hs. B ; 

3. dass das NltUataka unmöglich von dem dem 7. Jahrhundert 
angehörigen, von I-tsing erwähnten Bhart^hari 1 gedichtet worden 
sein kann. 

Der erste Schluss würde nur dann hinfällig, wenn man das 
NltUataka beträchtlich in vorchristliche Zeit hinaufrücken wollte, 
wozu aber sicherlich jede Veranlassung fehlt. Uebrigens ist das Pan- 

r 

catantra, wie ich an einem anderen Orte darthun werde, von Siva- 
däsa und anderen späteren Erzählern in seinem poetischen Teile 
.stark geplündert worden, so dass sich der Schluss geradezu auf- 
drängt, dass das NltUataka nichts weiter ist, als eine Anthologie. 

Zwickau (Sachsen), 3. Februar 1902. j 0HANNES Hertel. 



■o 






O -ö 
^ fl) 



w I 

, O) 
O u 



o o 

c v> 
o E 



F p. 



u 

O <L> 



Pietro della Valle über das Nägarl-Alphabet. — In meinem 
Aufsatz über das Devanägari- Alphabet bei Athanasius Kircher (oben 
xv, 313 ff.) habe ich gezeigt, dass das Alphabet der Brahmanen zum 
ersten Male in der China illustrata dieses Autors gegeben worden 
ist. Aber welcher ist der erste europäische Autor, der dieses Alpha- 
bet mit dem uns geläufigen Namen bezeichnet? Wie ich bereits 



1 S. v. Schroeder, Indiens Lit. und Oultur, S. 5G3 f. 



> <u 

C CT 
=> O 

— o 

c O 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



20*5 Kleine Mittheilungen. 

a. a. 0. ; S. 319 Anm. ? bemerkt habe, führt O. Dapper, Asia (Nürn- 
berg 1681) S. 58 die Bezeichnung Nagher (= Nägari) auf Kircher 
zurück. Die angezogne Stelle lautet bei Dapper vollständig: 

,Nach des Della Valle Bericht, haben alle Indianische Land 
schafften fast einerley Sprache, wiewohl sonderbahre Buchstaben; 
dann obschon die Sprache in unterschiedlichen Ländern verstanden 
wird, so sind doch nichts destoweniger die Buchstaben voneinander 
unterschieden/ 

,Überdiess haben die Gelehrten oder Geistlichen Indianer oder 
Brahminen eine Sprach und Art von Buchstaben, welche Kircherus 
Nagher, und andere die Hanseretische 1 und Brahoanische genennet, 
die ihnen eigentümlich zu stehet, und von den gelehrten Leuten 
ihres Geschlechts oder Stammens gebrauchet wird, gleichwie in Europa 
die Lateinische Sprache unter den Gelehrten üblich ist/ 

,Diese ihre Buchstaben sind schön und rein, aber sehr gross, 
und nehmen viel Platz ein. Sie sind auch um ein merkliches von 
denjenigen Buchstaben unterschieden, welche die Benjanische Kauff- 
leute in Suratta gebrauchen/ 

Wo Kircher die Buchstaben der Brahmanen Nagher genannt 
hat, ist mir nicht bekannt. Allerdings kenne ich bei Weitem nicht 
alle Werke dieses überaus fruchtbaren Schriftstellers; 2 aber ich finde 
den Ausdruck Nagher gerade da nicht, wo Kircher Anlass oder 
Gelegenheit gehabt hätte ihn zu erwähnen: z. B. nicht in der China 
illustrata* nicht im Prodromus Coptus (Romae 1636) p. 106 sqq., 
wo Kircher, nach der Vita Xaver ii des Joannes Lucena, die In- 
schrift 3 um die crux miraculosa S. Thomae apostoli mitteilt; nicht 
in dem wundersamen dritten Kapitel des dritten Teiles des Oedipus 
Aegyptiacus (Romae 1654), das den Titel De literis Brachmanum, 
siue Gymnosophistarum führt. Dennoch mag Kircher den Namen 
>.£ 

1 Druckfehler für: Hanscretische. 
■- ® 

2 Siehe Backer, BiUiotheque des icrivains de la Compagnie de Jims, i, 

p. 422—433. 

s i 

— -M 






Cl 



cn 



<=> o 



F P. 



3 Ueber diese Inschrift vgl. Burnell, Indian Antiquary in, 308 ff.; Germann, 



ru 

Di* Kirche der Thomaschristen (1877) S. 285 f. 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



0} 
T3 






Cl 



03 



(T3 



F p. 



u 



'(L) ¥? 



Klkine Mittheilungen. 207 

Nagher gekannt und in einem seiner zahlreichen Werke erwähnt 
haben. Stand er doch mit Reisenden und Missionaren, die sich in 
Indien aufhielten oder aufgehalten hatten, in lebhaftem, schriftlichen 
wie mündlichen, Verkehr. Es wird genügen, hier an das zu erinnern, 
was ich früher (WZKM. xv, 315. 316 n. 3) über die Patres H. Roth 
und A. Ceschi 1 mitgeteilt habe. Jedenfalls war Kircher selbst nie- 
mals in Indien: er muss also ftir den Namen Nagher einen Ge- 
währsmann gehabt haben. 2 Und wer ist dieser Gewährsmann? Ohne 
Zweifel der berühmte Reisende Pietro della Valle, den Dapper in 
dem ersten der oben ausgehobnen Sätze citiert; derselbe Della 
Valle, der jenes koptisch-arabische Glossar 3 nach Rom brachte, das 
nachmals von Kircher in seiner Lingua Aegyptiaca restituta ver- 
öffentlicht wurde und das noch heute für die ägyptische Sprach- 
forschung unentbehrlich ist (vgl. z. B. Erman in der Allgemeinen deut- 
schen Biographie xvi, 1 ff.). An drei Stellen seiner Reisebeschreibung 4 
spricht Della Valle von dem Nägari -Alphab et und nennt es Nagher 
(oder Nagheri), wie wir sehen werden. Da Kircher, nach dem 
Zeugniss von Dapper, den Namen Nagher genau wie Della Valle 
mit einem gh schreibt, 5 so wird der letztere bis auf Weiteres als 



1 Den Pater A. Ceschi erwähnt Kircher auch in seinem Oedipus Aegyptiacus 
m, pp. 22. 27. 

2 Es ist sehr wahrscheinlich, dass nur ein Irrtum auf Seiten Dappers vor- 
liegt, wenn er den Kamen Nagher auf Kircher zurückführt. Derartige Irrtümer 
kommen vor. So behauptet Polycarpus Lyser in seiner Dissertation De origine 
eruditionis non ad Judaeos sed ad lndos referenda (auf die mich Professor E. Kühn 
aufmerksam gemacht hat), Vitembergae 1716, p. 43, das Brahmanenalphabet in der 



China illustrata des A. Kircher stamme aus der Vita Xaveriana des Joh. Lucena! 

3 Della Valle, Reiss- Beschreibung i, 111. Kircher, Prodromus Coptus, p. 196. 



4 Ich citiere die Reiss- Beschreibung des P. della Valle nach der deutschen 
Uebersetzung, die zu Genff 1674 bei Joh. Herm. Widerhold in vier Teilen erschienen 
ist. Das italienische Original liegt mir vor in der Ausgabe von G. Gancia, Brighton 

" N 

1843. Eingesehen habe ich auch die alte englische Uebersetzung der Reisen des 
Della Valle in Indien vom Jahre 1664 in der Ausgabe von Edward Grey, London 
1892 (Works issued by the Hakluyt Society, nos. 84—86). 

-" o 

5 Als Italiener schreibt Della Valle Nagher (oder Nagheri); ebenso schreibt 



er z. B. Gioghi (= skr. yogin), während der Franzose F. Bernier Jaugui schreibt 

{Travels in the Mogul Empire ed. Constable, p. 316). In der Schreibung Nagher 

14** 

o c 

E => 

ro <V 

in _c 



Original fronn 



£ CO >"» I 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 






Cl 



(T3 



2 5 



F P. 



u 

- 0) 



208 Kleine Mittheilungen. 

Kirchers Quelle und als der älteste europäische Autor, der den 
Namen des Brahmanenalphabetes erwähnt hat, angesehn werden 
müssen. 

Della Valle hört von dem Nägarl- Alphabet zuerst in Combrü 
(jetzt Bender Abbas) in Persien — also noch ehe er den indischeiv 
Boden betritt — im Jahre 1622 (siehe Reiss-Beschreibung m, 229). 
Hier wird er mit einem indischen Geistlichen, mit einem von denen, 
,die sie Sami 1 nennen' (m, 217), bekannt und erhält allerlei Be- 
lehrung von ihm über die Götzen und Götzenbilder. Er erfährt 
z. B., dass Sri in Sri Narsinha ein Ehrentitel ist, und dass NarSinhk 
Mensch-Löw bedeutet. Der Sami wird von Della Valle gebeten, 
seinen eigenen Namen (Damodel Sami) und den der Götzen auf ein 
Blatt Papier zu schreiben. ,Er that solches 2 mit einer Gattung von 
Buchstaben, welche, wie er mir sagte, Nagher genandt, und von 
ihnen als heilig hoch geachtet würden, und durch gantz Indien unter 
den Gelehrten bekandt, auch von der Banianischen Kauffleuthe von 
Cuzarat ihren, von denen ich ein Alphabet habe, gantz unterschieden 



waren/ 



Der Sami erzählt ferner: ,dass schier alle Landschafften in 
Indien ihre sonderbare Sprach, und Buchstaben hätten, und ob wol 



sehe ich keineswegs c a curious tendency on the part of Europeans to insert the 
letter h in Oriental words* (The travels of Pietro della Valle in India ed. Grey 
p. 113 n. 2). 

1 Della Valle erwähnt die Sami öfters. Nach Edward Grey a. a. O., S. 75, 
wären die Sami = Swami, die Herren (skr. svämin). Die Richtigkeit dieser Er- 
klärung muss ich dahingestellt sein lassen. Sicherlich falsch ist aber die Identifi- 
cation der Vertia bei Della Valle iv, 37 mit den Vai§navas (Grey p. 104 n.). 
Es wäre wunderbar, wenn ein so genauer Beobachter und ein so treuer Bericht- 
erstatter wie Della Valle die Jainas nicht kennen gelernt und beschrieben hätte. 
Unter den Vertia sind ohne jeden Zweifel Jainas zu verstehn. Hebt doch Della 
Valle als Haupteigentümlichkeit der Vertia hervor, dass sie sich, im Gegensatz zu 
anderen Indern, das Haupt scheeren. 

* Der Sami weigert sich also nicht, ,seinen Namen schriftlich zu geben*, wie 
der König der Gioghi bei Della Valle iv, 124*. lieber den namentlich bei wilden 
Völkern hervortretenden Widerwillen, den Namen zu verraten* vgl. z. B, Richard 

fD 

Andree, Ethnographische Parallelen und Vergleiche (Stuttgart 1878) 179 ff. 302; 



Frazer, The golden bough* i, 404 ff. 



.E -ö 
-ö v 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Kleine Mittheilungen. 209 

etliche wenige an der Sprach einander verstünden, so hätten sie 
doch eine gantz andere Schrifft. Es ist demnach unter ihnen ins- 
gesamt einerley Sprach, und einerley Schrifft, nehmlich mit den 
Buchstaben Nagh&r, nur allein den Gelehrten bekandt, welche sie 
alle annehmen und verstehen; eben wie bey uns in Europa, allwo 
so viel, und unterschiedliche Nationen, einander insgesamt in der 
Lateinischen Sprach, und Schrifft verstehen/ 

Della Valle fügt hinzu, dass er von den Nagher -Buchstaben, 
<* 

die schön und deutlich, aber grob sind und einen grossen Raum 
i^ 

einnehmen, viel geschriebene Bücher gesehen hat, dass er zwei von 

diesen Büchern mitbringen will (vgl. Reiss-Beschreihung iv, 27), und 
dass er mit Lust und Verwunderung zugesehen hat, wie der Sami 
die Feder hielt und schrieb. 

Zum zweiten Male erwähnt Della Valle die Nägarlschrift bei 
der Beschreibung seines Besuches von Cambaia (Cambay in Gu- 
jarät). Er lernt hier einen alten Brahmanen kennen, der sich Beck 
Azarg nennt, , worunter Beck sein eigener, Azkrg [skr. äcärya] aber 

sein Ehren-Name ist'. Dieser Brahmane ,zeigete uns seine Bücher, 
£ g 

welche mit einer alten, allein den gelehrten bekandten, dem ge- 
meinen Mann aber heutiges Tags unbewusten, und bey den Brah- 
manen gebräuchlichen Schrifft geschrieben waren, die sie zum Unter- 
schied vieler anderer gemeiner, und in unterschiedlichen Indianischen 
Provintzen üblichen Buchstaben, Nagheri nennen' (Reiss-Beschreibung 
iv, 27). 

An der dritten Stelle seiner Reisebeschreibung, wo er die Nä- 
garlschrift erwähnt (iv, 40), wagt Della Valle eine Vermutung über 
den Ursprung des Namens Nagher. 1 Er besucht in einem Dorfe 

fD ^ 

Namens Naghra, 2 das zwei Cos von Cambaia entfernt liegt, einen 
dem Brahman geweihten Tempel. Von den Baniani oder Kaufleuten 

O <L> 

£ 

1 Ueber den Ursprung und die Bedeutung des Namens Nägari vgl. Colebrooke, 
Mücellaneous Essay» 1 n, 27, n., und namentlich Burnell, Elements of Soutk-Indian 
Palaeography 1 p. 42, n. 2. 

2 iv, 38 schreibt Della Valle: Hagrä. So auch im italienischen Original 

fD 



^ fl) 



w I 

fN CO 

f\l ^ 

, O) 

° m 

i fD 



o E 



(D 



§ S 



(ed. Gancia, ii, 563). 



.E -ö 
-ö v 

E-e 

E => 

fD <V 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



210 Kleine Mittheilungen. 

in Naghra hört er, dass dieser Ort vor alten Zeiten der könig- 
liche Sitz und die Hauptstadt des ganzen Königreichs Cambaia ge- 
wesen sei. Dies bringt unsern Autor auf die Mutmassung, dass die 
Buchstaben Nagher ihren Namen von der Stadt Naghra bezogen 
haben, weil sie vor Zeiten daselbst im Gebrauch gewesen sein könnten. 
Doch ist diese Herleitung eben eine blosse Mutmassung; Della 
Valle hat durch vielfältige Erfahrung gelernt, dass bei Auslegung 
und Ableitung der Namen, sonderlich aber der Städte und Plätze 
in der Welt, der Gleichheit der Wörter nicht zu trauen sei. Nagher 
bedeutet, wie Della Valle noch hinzufügt, in der Indianischen 
Sprach eine grosse Stadt. 

Wenn dereinst eine Geschichte unsrer früheren Kenntnisse von 

o 

Indien geschrieben werden wird, eine Geschichte, die anders aus- 

fallen wird als die kurze Skizze in Lepmanns Geschichte des alten 

Indiens S. 1 — 24, so wird auch der Name des ,Pilgers* Pietro della 

Valle, dem bereits Goethe ein unvergängliches Denkmal gesetzt 

hat, 1 mit Ehren genannt werden, ebenso wie in der Geschichte der 

Aegyptologie oder in der Geschichte der Entzifferung der altpersi- 
£ g 

sehen Keilinschriften. 2 

Halle a. d. S., Weihnachten 1901. Th. Zachariae. 

t fi, 



1 In den Noten und Abhandlungen zu besserem Verständniss des Westöst- 

™ O) 
^ u 

jenige- Reisende, durch den Goethen ,die Eigentümlichkeiten des Orients am ersten 



liehen Divaus (Weimarische Ausgabe, Band 7), S. 189 — 211. Della Valle ist der- 



o o 

und klarsten aufgegangen*. 

8 Della Valle hat zuerst (1621) mehrere Keilschriftzeichen richtig copiert 
und zugleich die richtige Vermutung ausgesprochen, dass diese Buchstaben ,auf 
unsere Weise von der lincken zur rechten Hand geschrieben werden* (Reiss-Be- 
schreibung in, 131 f.). Vgl. den Grundriss der iranischen Philologie n, 65 §. 29, wo 
die Jahreszahl 1621 für 1622 eingesetzt werden muss. Der Brief des Della Valle, 

worin von der Keilschrift die Rede ist, ist vom 21. October 1621 datiert, nicht vom 

u 

21. Oct. 1622, wie in der Beiss- Beschreibung in, 139 gedruckt ist; vgl. Viaggi di 

Pietro della Valle il Pellegrino ed. Gancia vol. n, p. 228. 269. 

fc =9 
> <u 

C CT 
=> O 

— o 

CO 

£ -o 
-ö v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Tigriiia -Texte im Dialekte von Tanben. 

Voa 

m 
6 

Enno Littmann. 

O 
(N 

0> 

Mein Aufenthalt in Jerusalem im Januar 1900 während der Arne- 

TD 

rican Archaeological Expedition to Syria (Vorbericht im American 

Journal of Archaeology, Second Series, Vol. iv, No. 4) war haupt- 

■^ 

sächlich dem Aufzeichnen von neuarabischen Märchen und volks- 

-c g 

tümlichen Liedern gewidmet (vgl. Abhandlungen der Göttinger Ge~ 
sellsch. der Wiss., PhiL-hist. KL, N. F. v, 3). Daneben aber beschäf- 
tigte ich mich, soweit es die Zeit erlaubte, mit den in Jerusalem 
lebenden Abessiniern. Ueber ihre Klöster und Handschriften s. Aus 
den Abessinischen Klöstern zu Jerusalem, in Zeitschr. für Assyr. xvi; 1 
ein Exemplar des amharischen Marha 'Ewür kopierte ich vollständig, 

o 2 

aus anderen Handschriften beträchtliche Teile. Von ferneren hierher 
gehörigen Arbeiten seien eine mit Hülfe des trefflichen Abbä Kefla 
Giorgis angefertigte Uebersetzung der altamharischen Königslieder 
und eine Anzahl von amharischen Strophen erwähnt, die von einem 
inzwischen verstorbenen abessinischen Barden stammen. Im Folgenden 
veröffentliche ich einige kurze Tigriila-Texte, die der aus Tanben ge- 
bürtige junge Mönch Walda Tensä'ü für mich anfertigte. 



> <u 

C CT 

=) O 

— o 



03 



fD 



1 Die wenigen äthiopischen Handschriften im griechischen Kloster sind be- 



schrieben in ZA. xv, S. 133 — 161. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVL Bd. 15 

o "E 
E => 

in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



212 Enno Littmann. 

I. 1 

i Hiä, » An i >n& s höh. i A-r-t f vo-h- 1 tu* • rt-flX » «?£ •■ n.-f- •■ 

2 A-fl* » M*f-*Afc- i MflCP a MA4- 1 «"»f-UC i }fl£ I fl-n i <»>fiih 
h-Kf ■ A£fc, » 4¥* • AAA4- » ?£• » IM- » A«l « «7fl£ « fl.'h » A*! » M 

3 i-SAh- : fcffXC?<"»-fc » J^h^i i flA-I tl£ W *» MCP « Ml IM-? • 

ww- • hrzd - &£&> ■• Miaa-p^ : thüd. i -him • n^t • aiaä • 

+*lAj frlfelfll » rh£,A • -MflA. ' rh^Ä* • M1*A ' lhf& 1 ?°Att ■ 

4 f *»AA£ ö hfiXW i Ml*«""»«* 1 £<»• » IIA« « Xfr ! M^-lft 8 » AA 

5 h'K-VMr* : flA-* I AM'A ■ f<*»AAA?£ ■ IIA- « XM-MCPlfc « **> 
+£ ■ £111C • Ml£ I >WllM*'> • *£4- » A-flAAT-^ •• #hA£, ' fc* • V+ 

£j>° •■ -MfiA. i tafei* ! £-n<:p- * fc* = A3.A » +hA. ■ *h< w, £: •• fcA 

6 £# : fl.A#r • »iCi" « MUlfrlh/" • fÄATYH^ I fc* » V+fc? • 

•Hia. •■ ♦*£*. ■ 9°Ä"n^-^ •• Vflh • n,+ •• rt-fl • hwKh • hi-t-ahi. » 

7 fc£ l rfv*LA » -Mfl A. i A«»*: * AA£# i ?&h ' fc-f' * A-fl • A.TI h •■ 

l_ ih 

.j.<j,*/n T : flA- 4 » AA-fl • ho°YldV ' "VA'l* ' Ä"lM» ' fcfc » 

3* , T 

1 Ich gebe die Texte genau nach dem Originale, abgesehen von der Inter- 
punktion. Die 5 und SS stammen vielfach von mir. 

» MS. h££-f 9°. 3 Im MS. verbessert aus h^f" 

* L (1A. 5 L M"!.^ (?) 



ö. 2> 
t! öi 

.c o 



w I 

fN U) 

^ U 

° m 



o E 



ru 



2. 
i 2kAtl[f]JtC •' h^fr^ » i rtA. I ^fl»-?f't ' VlC i hhtth s hl* i 

*j^ i jrn** •■ <w»-nA* ' AÄifl •• A-n i TÄ-jn.K'flA.c » ^a » Mia 



$ 5 

= 1 

— "r? 

£ ö- 

2 

u 

«4- ~° 

o <u 

N 
'-i-j 

"a 

3 O 
^ O 

c O 

.E -ö 
-ö aj 

E-e 

E => 

fD O) 

1 i Digilized by ^OOglC CORNELL UNIVERSITY 

ü Q_ 



ms Xi9°\L£ 2 ms h^°fr^ 



Original fronn 



Tigrina-Textb im Dialekte von Tanb£n. 213 



Es war [einmal] ein Mann, dessen Vater gestorben war. Seines 
Vaters Familie [und] seine eigene Familie machten ihm zu schaffen, 
indem sie mit einander stritten. Es war ein Philosoph, ein Lehrer. 
Er schickte Boten zu dem Philosophen [und] Hess ihm sagen: 
Meine Familie [und] meines Vaters Familie machen mir zu schaffen, 
indem sie mit einander streiten. Rate mir! [Die Boten] gingen und 
sagten [es] ihm. Er sass auf einem Sessel, sprang auf den Boden, 
[und] ging nach draussen; sie sahen ihn, wie er eine alte Pflanze 
abschnitt und eine neue Pflanze mit Erde umgab; eine Antwort gab 
er nicht. Sie gingen und traten vor [den Absender^ hin. ,Was hat 
er zu euch gesagt ?' sprach er zu ihnen. ,Uns hat er nicht geant- 
wortet/ sagten sie. ,Aber, als ihr [es] zu ihm sagtet, was that er 
[da]?' Sie sagten und sprachen zu ihm: ,Er sass auf einem Sessel, 
[und] ging [dann] nach draussen; die alte Pflanze schnitt er ab und 
warf sie fort, die neue Pflanze umgab er mit Erde/ [Er antwortete:] 

.Habt ihr denn nicht verstanden? Während er mir dadurch, dass er 

c ° 

die alte Pflanze ausriss und wegwarf, sagte: Jage deines Vaters 

_ in 

Familie fort, hat er, indem er die neue Pflanze mit Erde umgab, 
gesagt: Nimm deine eigene Familie und bleibe wohnen. Was der 
Mann mir hat raten lassen, ist von guter Bedeutung/ 



Q. 



i fD 
O o 



(T3 



2 5 



F P. 



u 

«4- ~° 

O <L> 



2. 



Alexander sprach so: ,Fünf Dinge sind, die wertlose Dinge 
sind: Feuer in der Sonne; Regen in der Wüste; gutes Buch, blin- 
des Auge; gute Speise, satter Mensch; Gottes Wort in einem Ge- 



walttätigen. Nicht wahr? das ist wertlos*. 



Von den Weisen waren [einige], die den Abuzared fragten: 

,Lehre uns Weisheit, die unserer Seele nützt, die für unser Fleisch 

ist/ ,Es ist so, wisset, höret: Vier Dinge thun dem Auge wohl, 

lassen es in die Ferne sehen. 

15* 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



CÜ 






O ^_ 



w I 

fN CO 

f\l ^ 

, 0) 

O o 

c w 

o E 



(T3 



$ 5 



F P. 



u 

O <L> 



Sc ? 

> <1> 

C CT 

=> o 



214 Enno Littmann. 

Afc£fc : ^ii\9°9°9 > « W7£ •• a/^p i pcr-KP •• y^vtp •••• *icn**t : 

6 >1C * ^JP-JPJP : SM,? x « Ö i; : >7C » A^JE* s HCTt • Ajlff»? : A?° 
Air* : »/*<; : -MfiA. i ^Otf. f ff4-£ i °7£ « ÄAA. • °7£ • «"C*Jß. I 

7 &?'V.h i «"Cltf- 1 tf-ÜA. • ^J&">»1 1 «"tfvhA » ACM-fr • >7C • A*J£fc* 
A.T < P*S p i -MM • »•> * -flM"V » ««WlA* ss AT»* • "?£ » JtflC?iA»l 
A.£A « 0*h£ » W-A'JLH. • M-tMtCh • AAfcA. • «•C^JB. « *A* • *A* 

s avyi : odcijs. « hcn-u i *7C • A/"Ph •• ajmi* » •• Ä-n-4» • h« 
rh m •• vjihi • A'fih 5 *° ^ w » Ä-n-4» » ?£;»" » Jwiav* » 0°;h^A * 

9 IDl* •* >7C i A/**.? •■ Af Ä-fl*}" •* l"?* •* i»P • r-flA* • «IllM : hOh 
AP • MlAn^-fc I hflHtfl « -AH"* • «°*Tr « flrh£ * h7+ • A.M*o> : 

io JtCO'fc i *7C » PMltP* kl»? i -fllH i JFWIA* ' nW-A* 'VlC * 

aom.th • 9"A4.U i Mh i lltd « V7C • {P°hA»lA « -M*» i 0°*71<P » 
A£«7fld • *7C « 

n hOl-b • HC i A/"P i A.rThJ> +J p ■ Ml.^-f J»° • fcf- «° » •IIA*'?* ■■ 

<w>7^ : JT-hÄ" I fcTfl* • A<:A ■' JT»4»"7T : £tl.<n>-»l : h*}^A- s «•»l^.i 

i2 rhÄ-'i/t^^'An^-t-yji^fl»-» *Jcn't'Vics^Ä"i*}j p »A/ M ^» 

Ä*n*4» » Ad ? ÄTfl'4» ■■ <wrüC •■ 1-j&^- ? «"(h* • &.?% I VA'flh •■ AA 
i3 CÜ • AflJ&-/: i Ay.Ä'd i ^Ch. ■ AAtl i A.+'l-A?* i Ä-V-d » *<J • ÄT>-d ' 

AM: "(1 H"i i m.A : ÄA^h ' CM i 9°9^V a 
H ^.IL i A*<f.TA • Ä-fl'* i <PC^. •• AA-n ' Klth » K$ > TÄ-fr* • 

V1C » C?irt i ?iP i -nH*J& i l^H-n » ^VJR ■ (Dp&C » ^IM-h-A- « ATI 
15 -ni»« , >.J&n'H'V-aÄ-fl-4»!'PC^.:J&4.*C'?iPa«>A9 s'n7V^:^9 AA.- 



1 ms $W 



2 So diktiert; MS. J^hÄ". 

3 - mfl'fl'l' (?)• 4 so ms. 



.E -ö 
-ö aj 

E-e 

E ^ 

fD 0) 

1 S Digilized by L^OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Tigrina-Texte im Dialekte von Tanb&n. 215 

Vier Dinge machen das Auge krank. 

Wiederum machen sie das Fleisch fett, [und] machen es mager. 

Vier Dinge machen es krank, [und] machen es gesund. 

Vier Dinge, die Licht für das Auge sind: Eine grüne [Gras-] 
Pflanze zu sehen; klares Wasser, fliessendes Wasser zu sehen; deinen 
Freund zu sehen; dein Auge mit Salbe (oder Stibium) zu bestreichen. 

Vier Dinge, die das Auge verderben : Viel Salz [und] viele 
Speise; heisses Wasser, das sich über deinen Kopf ergiesst; indem 
du immer die Sonne anblickst, nach oben zu sehen; Tag für Tag 
deinen Feind zu sehen. 

Vier Dinge, die deinem Fleische wohl thun: Ein gutes Kleid; die 
Trauer von deinem Herzen zu jagen; guter Geruch; wenn es warm 
ist, zu pflügen (?). 

Vier Dinge, die dem Fleische nicht gut thun : Schlechtes Fleisch 
essen; viel mit dem Weibe zu verkehren; im Bade viel zu sitzen; 
wenn die Sonne nicht untergeht, zu pflügen (?). 

Vier Dinge thun dem Fleische wohl: Zur [rechten] Zeit essen; 
in allen Dingen mit Mass handeln; sich von schlechten Dingen fern- 
halten; Trauer zu vertreiben [und] unnötige Dinge (?). 

Vier Dinge sind es, die das Fleisch verderben ; diese sind : 

in i/) 

Auf schlechtem Wege wandeln; ein störriges Pferd reiten; einen 

rsi g 

Weg zu gehen, wenn er dich ermüdet; das Kommen eines alten 

Weibes. 

™ 2 

Vier Dinge retten das Fleisch: Ein gutes Herz; ein guter 
Lehrer als Herr; ein guter Freund; eine Frau, die nach deinem 
Herzen handelt; ein hülfreicher Freund. 

Was das Herz tötet, [ist]: Starke Kälte; starke Hitze; viel 
Rauch; deinen Feind sehend, furchtsam zu sein'. 

Es sagte Socrates: ,Ein gutes Urteil ist des Menschen Stärke, 
einer guten Sache Haupt ist es. Dadurch werden Schätze gewonnen; 






F P. 



u 

«4- ~° 

O <L> 

CT 



cn 



das Heer ist ihm unterthänig und sein Volk wird viel. Ein gutes Urteil 
bringt Freunde (?). Die Welt wird mit einem Garten verglichen: 
des Gartens Zaun ist das Reich. Und die Weisen des Reiches sind 

.E -ö 
-ö v 

E-e 

E => 

(ü <D 
to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 



ö. ^ 
.c o 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c w 

o E 



E ö- 

o ö 



21(3 Enno Littmann. 

i6 c.9* t wM-r • fcf-r ? A<o;»vh£n • A.ixrfc • 77V x « An-/" x » 



1 *iVh fiTf •• 77-/*' » miä •• n<*°- * h awi » £fl*h a « £x « n-n * «*>7 

2 AA*» « fcf- * M"7A : JW •• 9*7*7 ' *il<fiA i hl i M i £7rhA • 

A.HWiA « J&iML i Vi>°n<5 •* fcftfl i h-OK. ■• •Mf£** * £+<">T • }fl£ I 

$ '>.<•'!• s A.OrhA » M. « hU7 • >IU a Ms : *£«-£■ i ++A-W" • hift* ' 

4 ii>nn-i: i w-i- • A.*<tf s » 77-/** •• hA.-n • äm-jb. » A°V^ •• w»ite • Ah 

Ill.JrfWi.C * A«w»V • ^Ä"*! •• -l'h A* i fl^ÄVJ 1 ^i-fc : «"»"ML ! A*»°*7 •■ 
5 hM- • +-I-A- « A,hlii * £*7 * A'fl ' ?ilt*£ • W-A- • j&^fllAr f <fiA*hA> 
1°7n ' hdt • hhl& • fl*A • tf-A- ' J&AATP ■ 



4. 

2 fhR, * '>?•/*' «■ >fl& s tiA* •■ ä* ■• vnc?» « nA.<w»a>-v » ^l^i « 
A.fl fl* ' •■ A+ » Ji fl .?• ■ >i m •■ 7 n.ch« » a* •• 70-fl • Miau * ++ 

5?, 



3 «n»m. i IIA ■ 7°'t ? Vi 0°1I ' *7* •' lAd-T" « Ms * 7fl.£ » +fck » A* ■ 

5 ¥hi s IIA- 5 ? hÄh-i i flA- « 7 Alt. •• nunC i <»"A.h« » -nAftl « HÜdiC* 
°iMi • 7H4- 1 h+o»m i Ä*<-J& ■• <»C* •• WUX* ' 'fecn-l* • Wibl • 

6 i j?.<. i A* •• M1.JP. •' rho»- 1 Äfl>«/ , ü » flA. i MitlA-L'h<F9" J ^Ä"> ! 

7 iTY.«" •■ ?»T ! «W-ftÄ* •• AA- a n^'fl « A'1'flV.V • <»-nn> • 7 A'V.' h-a^-- 

8 A<w>A^ » «»rtft, i Y\9°KM ' h^l-h i IM* > flA- a Jtfl^: iaV ni • 



2 JlP ist liier einige Male fast wie J^l*« geschrieben. 



4 = Artfl£+ 

5 ms. IIA- 6 ms. Xö>dJ p - 



u 

O <L> 

1 1 x So MS. 

> <u 

3 Vgl. hV^'H^fl^ •' fljR+C Guidi, TocaZ». 4wiar„ col. 460. 

.E -ö 
-ö aj 

E-e 

E => 

fD O) 

1 i Digilized by ^OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



■o 






Q. 

^ fl) 



w I 

fN tO 

, O) 

O u 



f 10 - 

O o 

c w 

o 5 



(T3 



$ 5 



F P. 



u 

«4- "ö 



CT 



Tigrina-Texte im Dialekte von Tanb£n. 217 

es, die den König stützen (?); ein dem Heere helfender König, ein 
dem König helfendes Heer ist ein Schatz. 



Es war einmal ein König von Abessinien, mit Namen Kaleb, er 
war ein wohlthätiger, geistlicher Mann. In einer an Mogas (= Bogos) 
grenzenden, Nagrän genannten Stadt war ein Jude, namens Pinehas. 
Ein ägyptischer Patriarch war dort eingesetzt und wohnte [dort]. Ein 
wohlthätiger Priester mit Namen Qirüt war [dort]. Der Jude tötete 
sie, indem weder Kinder noch Frauen übrig blieben. Als König 
Kaleb dies hörte, ward er betrübt [und] betete zu Gott. Indem 
sich die Erde aufthat, ging er auf einem Wege unter der Erde eine 
Woche lang und tötete ihn. Dem guten Manne, der betrübt ist, 
wird dies alles gethan. IJalhal, Mogas, Keren, Asgade, Baqlä: alle 
wissen es. 



4. 



Es war [einmal] ein König, der hatte zwei Söhne. Zu der 
Zeit, da er im Sterben lag, sprach er zu seiner Frau: Mache d^n 
älteren [Sohn] zum Priester und den jüngeren zum König. [Dann] 
starb er. Wie er ihr gesagt hatte, handelte sie. Der ältere [Bruder] 
wurde eifersüchtig und schmähte den jüngeren Bruder, indem er 
tadelnd sprach: ,Er hat betrogen; eine einzige Hand hat heimlich 
(wörtl. die bedeckt ist) das Königreich an sich gerissen/ Der 
schickte Leute und rief ihn; [dann] sprach er zu ihm: ,Was ist 
dir, dass du mich geschmäht hast?' Er antwortete: ,Man hat mich 
schlecht behandelt/ [Der jüngere Bruder] füllte einen Kessel mit 
Kieseln und that ihn in eine mit Saffian [überzogene] Kiste. [Ferner] 
that er reines Gold in eine mit altem Leder [überzogene] Kiste, rief 



den älteren Bruder und sprach: ,Von diesen beiden Kisten wähle 
[eine] aus und nimm [sie]/ Er nahm die mit Saffian überzogene 
Kiste, in welcher der mit Steinen gefüllte Kessel sich befand. 
[Darauf] sprach [der jüngere Bruder] zu ihm: , Bringe [und] öffne [sie]; 

.E -ö 
-ö v 

E-e 

E => 

(ü <D 
to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



218 Enno Littmann. 

n/w 1 » fc* » htx* » «/ä-j > h<L-t»i i <:fcp- : n/t- » ä*4-£ » <oc* » 

9 flPfrnl < A.«7 « *£■«*•? • -flAAA. • A°7+ • htf» » fc-M-ta £■>• • -nfc«7 

10 H.Ml<h.C i OhfOX^r : ff{.£ i <Dftf» * fc W* a A-°l i hfl)-? i A-fl i 



5. 

2 AR, • v+r » Mi i sojr i in-a • *>t-/** » Mi ■ hA***? » 

XAA-fc 1 A« W 1 h.¥l-h. 1 +AA* I ?»* s «JflJK. : *>7./" 1 A* * 70-A • 
Ttf» ■ -0^°*>^JK. ■• >7C 1 KP : A-fl? 5 wWtt • A.W1A* • MJR i 

3 hAhJB. • MVPt 1 fl A> :: MU& : ttf» : A* i *} 2Wl i IT-/»* • ♦+ A- ■ 

4 A-^d»«! 1 h?°h- : VW i A.1HD-? ■ Ä*ft-* 1 M& a AR, •■ ?7V 1 
£4<U •• M£ -• flA<f>, : fcfc l fiAji ' Vb/» * \WIP ! «»Ä. » +«"AA • 

7 £ °£4- ' 7H0- 1 A¥^' iftA,^' A££ : IH*A 1 ++<*»m « A.?°ffflH- • 

A-n •• ?°h<5 1 a.äat 1 A-ri 1 -a+ä-a •• /»»;» •• «a+ä-a » ><PA. •• £A • 

£AP:£WlC« 



.c o 



^ fl) 



w I 

fN CO 

fNI W 

, 0> 

^ u 

y 

O o 

c w 

o E 



1 So diktiert; MS. ursprünglich flA- 



- "r? 

£ ö. 

P 

U 
o <u 

*s 

> <u 

3 O 
^ O 

c O 

.E -0 
-0 v 

E-e 

E ^ 

fD 0) 

1 S Digilized by L^OOglC CORNELL UNIVERSITY 

a3 ^ 

ü Q_ 



Original fronn 



Tigrina-Texte im Dialekte von Tanben. 219 

sieh sie [dir] an/ [Jener] sprach : ,Es ist ein Kessel mit Steinen/ 
[Darauf] sprach [der jüngere]: ,Oeffne die alte Kiste und sieh [sie] an. 
Es ist reines Gold. Siehst du? Wir [aber], wenn wir [nur] äusserlich 
den [guten] Menschen gleichen, sind innerlich wie ein Kessel, wie 
Steine. Die Gerechten [jedoch, auch] wenn sie äusserlich schlechte 
Kleider anhaben, sind vor Gott in ihrem Innern reines Gold. Nun 
ist es also nicht nötig-, Menschen zu verachten/ 



5. 

Es war [einmal] ein grosser König und ein kleiner König. Die 
beiden waren Feinde und stellten ihre Heere zum Kampfe auf. [Da] 
sprach der grosse König zu dem kleinen König: , Warum sollen un- 
sere Leute und unsere Heere zu Grunde gehen? Ich und du, wir 
wollen kämpfen/ Der grosse König tötete den kleinen König. Heute 
nun, wenn es so ist, ist es gut: Es war ein furchtsamer König, der 
war klug; ein anderer König kam um ihn zu bekriegen. [Jener] 
sprach zu ihm : ,Kehre um in dein Land, ich will dir Tribut zahlen/ 
Da ging er. 

In einem Lande in einem Jahre wurden sie eingesetzt. Im 
zweiten Jahre bringen sie ihn auf eine Insel, er stirbt vor Hunger. 
Der eine König aber schickte von seiner Einsetzung an seine Schätze 
auf die Insel, er blieb in Freuden. Er wusste Rat die Leute zu 
unterstützen, die Leute erfreuten sich leiblichen und geistigen Ver- 
gnügens. 



CÜ 






o -ö 
3 * 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



Was den Inhalt der obigen Texte anlangt, so geht 2 mit seinen 
Zahlensprüchen direkt auf das mashafafaldsfä tabzbdn 1 und damit 
auf die im Orient vielfach so beliebte hellenistische Apophthegmata- 
Literatur zurück. Walda Tensäe sagte mir ausdrücklich, dass er 
diese Sprüche dort gelesen habe. Den Sachen im einzelnen nach- 



u 

«4- ~° 



zugehen, fehlt mir Zeit und Literatur. No. 3 zeigt, dass die Ge- 
schichte vom frommen König Kaleb und dem bösen Juden Pinehas 



> <u 

C CT 

=> o 

— o 

CO 

s S ______ 

1 Vgl. Cornill, Maslyifa Falds/d Tabibdn, Leipzig 1875. 

15** 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



220 Enno Littmann. 

(entstellt aus ^y $>) noch sehr beliebt ist; vgl. die erschöpfende 
Behandlung dieser Legenden von dem um die äthiopische Literatur 
so sehr verdienten F. M. Esteves Pereira, Historia dos Martyres 
de Nagran, Lissabon 1899 (Herr Professor Nöldeke erinnerte mich 
ferner an das Vorkommen dieser Erzählung im Gadla Aragdtvi). 
Woher Walda Tensä'üs die übrigen Geschichten hatte (die Kästchen- 
Erzählung in No. 4 ist ja auch sonst weit verbreitet), habe ich leider 
versäumt festzustellen. 

Die Sprache von Tanben ist, wie ja bereits Praetorium in 
ZDMG. 28, S. 437 festgestellt hat, dem Dialekte von Adua nahe 
verwandt. Wer das Tigrina — diese Benennung der Sprache em- 
pfiehlt sich, da sie sich schon im Klange deutlich von Tigre unter- 
scheidet — aus den Arbeiten Praetorius*, Schreiber's, und de Vito's 
kennt, findet sich hier leicht zurecht. Die meisten Abweichungen vom 
Dialekte von Adua hat Praetorius in seinem Aufsatze lieber zwei 
Tigrinadialekte (ZDMG. 28, S. 437 ff.) zusammengestellt. Vielleicht 
sind die folgenden Bemerkungen, in denen ich besonders die von 
Praetorius nicht oder weniger ausführlich behandelten Erscheinungen 
hervorhebe, dennoch manchem erwünscht. 

Ich erwähne von vorn herein, dass Walda Tensa'ä wenig 
oder garnichts von der gedruckten Tigrina-Literatur kannte. Danach 
können wir einerseits erwarten, dass er sich ungezwungen in seiner 
Muttersprache ausgedrückt hat, aber auch Inconsequenzen oder or- 
thographische Fehler wohl nicht hat vermeiden können. Auf letz- 
teres ist allerdings der bekannte Wechsel von ft und Q einerseits, 
Ü, rh> *i andrerseits kaum zu schieben; vgl. h(D*C ' °t¥*\ * 2 3 , t\f*\ 
2 5 5 TC°it> ,zu sehen' 2 6 und öfters, fCh^f* 2 4 ; ferner tf-UA., 
?°tfvhA 2 6 ; MI**«. 1», Jwh£# 1 5 J auffällig ist ^jp»y>JP 2 5 neben 
?ih9°9°1P ib. Die Schreibung fl*fl?i 1 2 (wofür sonst fl-fl) ist wohl 
Reminiscenz aus dem Ge'ez. 

Wie bekannt, hat das Tigrina (wie z. T. auch das Amharische) 
einige merkwürdige Eigentümlichkeiten mit den nordsemitischen 






T3 



.TD 






3 ^ 
— O 

Sprachen gemeinsam; so die Spiration des b und k (hier auch auf 
q ausgedehnt) und die hin und wieder vorkommende Assimilation 

.E -ö 
-ö v 

E-e 

E => 

ro <V 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Tigrina-Texte im Dialekte von Tanb£n. 221 

des n. Das aus ti*}(l entstandene ^»fl (Adua *?*fl) w ^ r d also läv 
gesprochen und kann vor stimmlosen Consonanten zu läf werden: 
A*P*fc ?zu ihm' 1 2 , A - ?^ - ? zu ihr' 5 6 . Ebenso kann ursprüngliches 
-abi- durch die Mittelstufe -am- zu -ai- werden VJR4» ls> I5 (für 
Vfl«4«)> "]£4* ;^r machte' 4 5 neben ifljf- ib. Endlich deutet wohl 
auch der Ausfall eines b im Auslaute auf eine sehr weiche Aus- 
sprache hin; t\}Y\ 2 3 10 für h^^Hl ist ja schon aus Praetorius, 
Tigrina- Sprache, S. 92 bekannt Für den in äthiopischen Dialekten 
mehrfach belegten Uebergang von b > m haben wir auch hier einige 
Beispiele: half* 2 5 ^wiederum'; «pffl 3 2 5 Bogos; f\9°f:d 1 3 für 

Dass n in dem heute recht selten gewordenen Pronomen der 
2. Pers. Sing, dem t assimiliert wird (vgl. nnx } ak), ist schon bei Prae- 
toriüs {Tigrina- Sprache § 108) und Schreiber (Langue Tigrai §51, 3°) 
berichtet. Weitere Beispiele liefern unsere Texte: J^fj 4 6 (für ft^fHl); 
ft'Th *5 ( w * e lTn Tigre) und ft-J» 4 9 ,indem' für ft"} 1 ^ ?!*}+; ferner 
&;*•£ 4 4 ? was?< (für Kl^f* bezw. J>°?;»-£), ^7^ 2 11? 3 4 ,Weg< 
(zu >7Ä). 

Ueber A i m Tanbendialekte für *} in Adua und Umgegend 
vgl. Praetorius, ZDMG. 28, S. 446; dafür eine Menge Beispiele auch 
hier, ich führe nur an: AK?fl I4 > uns aber'; AA?iA # 2 7 ,nach oben'; 

AAfl. s A.+^AP 1 2 is >die d as Herz töten' u. s. w. Neu ist in dieser 

^ <-> 

Beziehung, dass die Tigrina -Conjunction Y\*j ,indem' c. Perf. (dem 
tigrischen f\if^ c Perf. entsprechend) in unseren Texten ftiA lautet, 

Ol 

s. unten S. 224. 

Anhangsweise sei hier hingewiesen auf die Art von Vocalhar- 
monie in ^fWf l x (neben ^OKO; in £«7H«h«A- 2 14 , M^h« 5 2 
und ^h>h 4 8> sowie auf die Metathesis in Y\*h^l>&* 1 3 zu hil\d^ I5.7 
(vgl. Ge'ez A*^ pnn) und ßfl^P* 1 5 JPÄWM-P 1 6 zu sonstigem 
&Gflf ( v gl- DE Vito, Vocabolario s. v., ebenso Tigre und Ge'ez). 

Die Bildung der Pronomina und Suffixe im Tigrina ist eine 
der wunderlichsten Spracherscheinungen. Die Sucht nach Mannig- 
faltigkeit der Formen ist bei den Demonstrativen bereits im Ge'ez 
ganz hübsch ausgebildet; das Tigrina aber hat sich damit nicht be- 

E-e 






T3 
Q. 



F p. 



u 



fD 0) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



222 Enno Littmann. 

gnügt, sondern sie auch auf Personalpronomina und Suffixe über- 
tragen. Es nimmt uns also nicht wunder, wenn auch unsere Texte, 
so kurz sie sind, wieder etwas Neues beitragen. Wir sehen aus den 
Formen ftftfi 5 2 ,du<, ftft- 1 4 ,er<, htih^tYtf V> ihr '> dass in un ' 
serem Dialekte zur Bildung des Pron. person. in der 2. und 3. Pers. 
das Wort ftft-, (aus hGtl'> Chtl) verwandt wird, im Gegensatze 
zu dem sonst im Tigrina gebräuchlichen *}ft (aus >*pfl); Praetorius 
hatte also ganz recht, wenn er die von Beke angeführte vereinzelte 
Form esdthum als ^höchstwahrscheinlich einem ungebräuchlichen am- 
harischen ItiCfli'V 9 entsprechend' erklärte (Tigriüa-Sprache, S. 155). 
Wir werden nicht fehlgehen, wenn wir im Tanben-Dialekte folgende 
Pronomina der 2. und 3. Person annehmen 

Sing. 2. m. Jtfth Plur. 2. m. htlYt-9°, M*\W, htlh^\b9° 
3. m. hfr 3. m. hfl9°, KM9 

f M f K&% KWi 

Es ist merkwürdig zu sehen, wie sich hier in Abessinien in 
neuerer Zeit ein ganz ähnlicher Prozess wie bereits in uralter Zeit 
in Aegypten abgespielt hat; denn die ägyptischen wie koptischen 
Personalpronomina der 2. und 3. Person sind ja bekanntlich nichts 
anderes als nt -f- Suffixen. 

Die Pronomina der 1. Pers. lauten: J\% 5 4 und *}&*! 4 8 . Das 
auslautende e in ffo wird beim Antritt des enclitischen f, wieder 
verkürzt: Mf* 5 2 . Es ist mir wahrscheinlicher, dass dies e auf dem 
Boden des Tigrina ebenso wie in den Verbalformen >fl£ 1 19 1°^ 
ib. A&£, 1 2 u. s. w. (vgl. Praetorius, Tigrina - Sprache § 15) als 
Dehnung von a, ä aufzufassen ist, während ich im amharischen ftfc 
eher ein nochmaliges Antreten des Suffixes der 1. Person (wie in 
^x) annehmen möchte. 1 

1 In diesem Zusammenhange sei auf das neuarabische 'ani, bezw. 'dm hin- 
gewiesen. Ich habe es in Syrien von Personen beiderlei Geschlechts gehört; dann 
stände auch hier derselben Erklärung wie in vx nichts im Wege. Jedoch fassen 



ti öi 



^ fl) 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



i/i 



Spitta und Landberg, wenn ich mich recht erinnere, ani als Femininform zu ana 
auf; dann müsste irgendwelche Analogie zu hi, anti mitgespielt haben. 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Tigrina-Textb im Dialekte von Tanb£n. 223 

Als hervorhebendes Possessivpronomen haben wir genau wie 
im Tigre (Zeitschr. für Assyr. xn, S. 291 f.) «/£ mit Suffixen: Vß»» 
fl»*J* s A*fl lg ,meine Familie' u. s. w. Der Gebrauch dieses Wortes 
als Genitivpartikel ist bekannt; für den Tanben-Dialekt scheint es 
charakteristisch zu sein, dass VJ& * n diesem Falle sein J& verliert 
und dem Substantiv proklitisch vorgeheftet wird: VTiT \l>h*tt gh»C » 
^A 2 2 , h't** f j$&9 o * frYlii* l s.$ >die a l te Pflanze' (die Pflanze von 
vorher), u. s. w. Auch in Fällen, wo wir der Partikel mehr Selb- 
ständigkeit zuschreiben würden, tritt diese Verkürzung ein ; so z. B. 
VA*flh 2 12 ,das was deines Herzens (= nach deinem Herzen) ist'. 

Besondere Beachtung verdient die in der Entstehung begriffene 
Bildung eines Determinativartikels; im Tigre habe ich A als 
solchen ZA. xn, S. 299 ff. nachgewiesen. Hier haben wir jedoch ein 
anderes Demonstrativum in ähnlichem Gebrauche : (h) !*- In ft-j: i 

MR9° ■ -MFIA«, fc* ■ rMLJl • -MlA« 1 5 > in A* ■ JiflJ&, A* ■ ?0-f> 4 2 

(vgl. 4 S 5 ) u. a. kann meines Erachtens fo'p nur als Artikel erklärt 
werden. Leider sind keine Pluralformen belegt; vgl. noch Schreiber, 
Langue ligrat § 28, Note 2°: ^s equivaut souvent au simple article 
qui manque au tigrai*. So "fl*HlAfc£ ' ^ao^* 5 5 ,im zweiten Jahre'. 

Das Relativum lautet in Tanben A> v gl- Pkaetoriüs in 
ZDMG. 28, S. 446. Hierfür bieten unsere Texte eine Reihe von 
Beispielen. Die Stellung ist wie meist in den neuabessinischen Spra- 
chen direkt vor dem Verbum des Relativsatzes (vgl. besonders am- 
har. f). Doch hat ü im Tigre noch eine gewisse Bewegungsfreiheit; 
hier finde ich das eine nicht ganz sichere Beispiel AA"fl s K^^YlÜL I7 
,was der Mann mir hat raten lassen/ Ein Beispiel für die conjunctio- 
nale Anwendung des Relativums ist \\$*¥* s h£*>h * AÄ^*hhfc 4 4 ,was 
ist dir, dass du mich geschmäht hast'. Das ist echt äthiopisch ; im Ara- 
bischen haben wir es erst in späterer Zeit, vgl. Goldziher, ZDMG. 35, 
S. 523 f. Nur ein Mal finde ich in unseren Texten Tf, in h{F"H s 
Jl^5. 4 2 ,wie er ihr gesagt hatte'; einmal auch "J, in "J'MlÄ'i 4 s- 

Eigentümlich ist in unserem Dialekte der Ausdruck der Ne- 
gation: f . . . . J&, z. B. ftf»Artj& I3 ? er antwortete nicht'; fi^AA 
AV/& I4 > er antwortete uns nicht'; ¥&llT\b9 £> Iß- Be™ Imper- 



t; öi 



u 
n 

w I 

fN CO 

f\l ^ 

, O) 

° £ 
O o 

c v> 
Z " 

■0 

= 1 

- "r? 

£ ö. 

P 

U 
O <L> 

*S 

■h! ■— 
'i/i öi 

> 0> 
ö 

O 

o 

.E -ö 
-0 £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



224 Enno Littmann. 

fectum jedoch lautet der erste Teil der Negation wie in den anderen 
Dialekten ft£; vgl. ftj&*7fld£ 4 io > es * st n i c ht nötig*. In den Tanben- 
Texten, die Praetorius vorlagen, ist die Negation Y\$, — *|, oder 
Yif, — j&. Unser p wird in irgendwelcher Weise mit JiJ& (aus ftA) 
oder mit dem alten ^ zusammenhängen. Für £ scheint mir die 
Ableitung aus äthiop. ^ am wahrscheinlichsten ; es kommt ja auch 
in dem Doppelausdrucke -£: -£, ,und' vor, z. B. M& : }\tlU?' 5 s 
,ich und du*, wo die Bedeutungsentwickelung noch klar zu Tage 
liegt. Wie das -*} der anderen Tigrina-Dialekte fällt auch -f» wieder 
ab, wenn eine proklitische Conjunction oder das Relativum vor das 
Verb tritt, z. B. h'i't * A»+^ ^3 ,indem nicht übrig blieben*. Hier- 
aus ergiebt sich zugleich, dass ft + f in ft, contrahiert wird. In 

6 

einem Falle hat sich ff, in einen dem vorhergehenden Consonanten 
angehängten Vocal aufgelöst: hj&h»^ ,es ist nicht* in hp,\\»%P~ 2 2 
.nicht wahr?*. 

Die Conjunctionen schliessen sich denen der anderen Dia- 
lekte an. Nur ist natürlich zu beachten, dass in den mit dem Re- 
lativum zusammengesetzten Temporal- und Condicionalpartikeln A 
für 11 eintritt. Wir haben also einfaches ft'J'lh- oder fa^- (s. oben 
S. 221) im affirmativen Temporalsatze: M'fälCPYb V> hl't'ü 
Afc 1 6 ? dagegen Ji*}*f*sA im negativen Temporalsatze (h"} r f* * A»«f» 
i*$ 3 3 ) und in Bedingungssätzen: ft*J»f« : AjH0*1 5 4 ,wenn es ist'. 
W ,indem* für JiS" d er anderen Dialekte (s. oben S. 221) findet sich 
in ?fl-fc. : fl,^ s fy-nh : ?fc : &+ ' rt-flfc * M*HAh- * MFlC? 1 li 
,seines Vaters und seine Familie machten ihm zu schaffen, indem sie 
mit einander stritten*; vgl. weitere Beispiele in 1 3 . 

Zum Schlüsse sei noch auf einige lexikalische Eigentümlich- 
keiten hingewiesen. Wie zu erwarten, hat sich das politische Ueber- 
gewicht des Südens auch in der Sprache des nördlichen Abessiniens 
geltend gemacht; wir finden somit amharische Fremdwörter auch in 



w i 

fN CO 

° m 



o E 



§ S 



F p. 



manche der hier vorkommenden Wörter, die in den amharischen 



u 

O <L> 

*S 

unseren kurzen Texten. Es ist allerdings sehr gut möglich, dass 

> Q) 
C CT 
=) O 

— o 

Lexicis belegt sind, aber nicht in denen der Tigrina -Sprache, den- 
noch gut Tigrina sind, da uns der Wortschatz des Amharischen, 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Tigrina-Texte im Dialekte von Tanbän. 225 

namentlich durch Guides monumentales Werk, viel besser bekannt ist. 
H*4*7 ! 3 ,Sessel', h^-f" 3 4 4 7 ,öffnen', ff£J 4 7 ,mit etwas über- 
ziehen', hOhfCd 2 9 ,Bad<, +h«^ ,bewachen' in ft^tf-qjGil (atfairkä) 
2 7 u. a. mögen ursprünglich beiden Sprachen angehört haben; mir 
sind sie nur aus dem amharischen Lexicon bekannt. Vgl. ferner 
HP 2 8 ,Geruch<, «fe^m. 4 S »betrügen*, mm C 4 5 ,Kiesel<, 1&% 
4 6 ,Kessel' (so wurde es mir erklärt; vgl. jedoch amhar. 7A vas0 
fragile di terra, was an unserer Stelle sehr gut passen würde), 
M^A 4 3 heftig tadeln', (MiCi%-fl 4 5 ,Saffian<. Die Endung -8«, 
-gflfl ist durchaus amharisch; vgl. iv> > A2kln*h7 1* >Bote', rhA 1 ? 5 ? 1 3 
wurde mir ausdrücklich als ,draussen' erklärt, es ist im Amhar. 
,inneres Gemach'. Auch hfr 3 3 scheint rein amharisch zu sein; 
ft«? 4 6 ist wohl amhar. q ,und'. Das Wort tiSld I1.2 belästigen' 

rsi 

ist mir sonst nur aus Schreiber bekannt; es mag hier eine allgemein- 
semitische Wurzel vorliegen, zu 1« ,in die Länge ziehen' (?), vgl. zu 
der Wurzel Fränkel, Aramäische Fremdwörter S. 114. 

Der Verfasser unserer Texte, ein junger hellfarbiger Abessinier, 
fand in der Stadt der Hoffnung nur ein kurzes Siechtum und starb, 
ungekannt wie so viele andere, eines frühen Todes. Diese wenigen 
Blätter seien ein literarisches Denkmal für Walda TensA'A. 



T3 
Q. 



Princeton University, 22. Februar 1902. 



1 fD 
O o 

c v> 
o E 

.-^ 4-1 



-ö ±3 

§ i 

- "r? 

£ ö. 

P 

U 

O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 
C CT 
=) O 

— o 

CO 

.E -ö 
-0 £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



t! öi 



Eine epische Idee im Veda. 

Von 

Julius von Negelein. 

Die folgende Untersuchung will beweisen, dass der Grundzug 
der Räma-Sltä-Legende bereits in einer sehr alten Periode des indi- 
schen Lebens existiert hat und dass ihre Ausgestaltung in einem lange 
währenden Prozess durch die Thätigkeit von Sängerschulen unvedi- 
scher Art sich vollzog. Dadurch soll das Vorhandensein und die 
Funktion von epischen Dichterkreisen in einer Zeitperiode dargethan 
werden, welche dem priesterlich redigierten und fixierten Epos um 
ein sehr Beträchtliches vorausging. Hieraus dürfen weitere Schlüsse 
auf das Nebeneinander von rapsodenartigen und hymnenähnlichen 
Dichtungen in ältester Zeit gezogen werden. Die alten im Volke 
lebenden SagenstofFe sind nur widerwillig hier und da einmal von 
der priesterlichen Tendenzdichtung verwerthet worden, zufrieden, in 
der Form der Gäthä-Strophen zur Ausfüllung von Opferpausen durch 
die Priesterkaste gebilligt und vorgetragen worden zu sein. Den In- 
halt einer dieser volksthümlichen Gesänge festzustellen, wollen wir 
uns im Folgenden bemühen. 

Von den beiden indischen Nationalepen ist das Rämäyana bei 
weitem das populärere. Während das Mahäbhärata an die kriegeri- 
schen Traditionen alter Fürstenfamilien anknüpft, und deren Ge- 
schicke in tendenziös-theologischem Sinne zu interpretieren sucht, 
greift das Rämäyana tief in das eigentliche Volksleben hinein, indem 



T3 



03 



F p. 



u 

«4- ~° 

O <L> 



'öl 

CD 



g 

cü 

c 

— o 

ft3 

SS 

es die rein menschlichen Motive von Liebe und Eifersucht, Neid und 

.E -o 
-o v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by V^OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Eine epische Idee im Veda. 227 

Zank verwerthet, namentlich aber indem es nicht Götter, sondern 
einen einzelnen Helden in den Mittelpunkt unseres Interesses rückt 
und so an alte, echt populäre Traditionen anknüpft. Denn es liegt 
tief in der indischen und wohl ganz allgemein in der menschlichen 
Natur, eher seine Götter zu Helden als seine Helden zu Göttern zu 
machen. Während in der theologischen Auffassung des Christenthums 
der liebe Gott im Himmel thront, bringt das Volksmärchen ihn auf 
die Erde und erzählt oft von einer Zeit, in der der liebe Gott noch 
auf Erden wandelte. Während der feierliche Schwur im klassischen 
Alterthum den grossen Göttern galt, wendet sich die populäre Ver- 
wünschung an Hercules als den irdischen Ahn. Genau denselben 
Gegensatz finden wir zwischen der epischen Auffassung der Götter 
und der vedischen. Während diese, einem aufgeklärten Rationalis- 
mus huldigend, die einzelnen Gottheiten in himmlische Fernen ent- 
rückt, macht das Epos sie, wie Homer, zu Theilnehmern an den 
Freuden und Leiden der Menschen und lässt sie nicht selten unter 
diesen selbst recht zweideutige Abenteuer erleben. Ein Compromiss 
zwischen diesen beiden Standpunkten ist der Natur der Sache nach 
unmöglich. 

Wenn z. B. die Acvin einerseits an den Himmel als Götter der 

■* 

Frühröthe versetzt werden, andererseits als Aerzte auf der Erde 
weilen, eine unfruchtbare Kuh ergiebig machen, einen Schützling 
aus einer Cisterne hervorholen u. s. w., so führt die Vermengung 
beider Auffassungsweisen entweder dazu, die unfruchtbare Kuh ganz 
unverdienter Weise zu einem natursymbolischen Object zu stempeln, 



T3 









w i 

fN CO 

O u 



o o 

c v> 
o 2 



(T3 



oder aber dazu, die Agvin etwa einseitig zu Wunderdoctoren zu 
machen und ihre mythologischen Bezüge zu vergessen. Sobald wir 



F P. 



aber in dem mythologischen Theil der A9vin-Hymnen Legenden- 
keime sehen, die sich auf dem epischen Boden entwickelt wieder- 

o jjj 

finden lassen, ist alles erklärt. 

Wenden wir nun diese Auffassungsweise auf das Rämäyana 



> <u 
=> o 



an, von dem wir ausgingen. Weber hat in seiner bekannten Arbeit 

ru 



festgestellt, dass kaum ein Thema der indischen Litteratur soviel 



variiert ist als das jenes Epos. Unverändert aber findet sich als 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 16 

o c 

E => 

in 4-/ 
$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



228 Julius v. Negelein. 

Grundstock eine Anzahl von Qloka -Versen, deren hohes Alter schon 
durch sprachliche Gründe bezeugt wird. Diese Verse berichten uns 
von der glücklichen Regentschaft Rämas und von seiner Ehe mit 
der Sita. Wer war nun Sita? Sie selbst erklärt, keiner natürlichen 
Geburt, sondern aus dem Erdboden bei dem Ackern desselben spon- 
tan entstanden zu sein (R. 1, 66, 14 f.). Ihr Name bedeutet: , Acker- 
furche', ihre Schwester ist ürmilä, von Weber, Räm. 7 f. mit Recht 
auf das wogende Saatfeld gedeutet, ihr Vater, Janaka eine spät ge- 
bildete Persönlichkeit, nichts weiter als ,Erzeuger' bedeutend, und 
mit dem Beinamen siradhvaja, d. h. den Pflug im Banner tragend, 
ausgestattet. Sie ist also sammt ihrer ganzen Verwandtschaft eine 
höchst durchsichtige Personification des Ackerbaus oder vielmehr des 
bebaubaren Ackers. — Bevor wir nun die Geschichte dieser Idee 
betrachten, wollen wir uns fragen: ist diese Vorstellung vedisch? ist 
ein Räma im Veda wahrscheinlich, eine Sita wahrscheinlich und das 
symbolische Verhältnis zwischen beiden der vedischen Convention 
entsprechend? Bezüglich der ersteren Frage haben wir bereits be- 
merkt, dass die dichterische Verherlichung der Persönlichkeiten von 
Räma und Sita dem vedischen Usus umso mehr widerspricht, als 
wir dem Ahnenkult, dem die Persönlichkeit des Räma angehört, 
überhaupt keine grössere Rolle zugebilligt finden. Das gleiche gilt 
nun aber von dem Liebesverhältniss zwischen beiden. Es ist ein im 
Veda ganz hervorstechender Zug, dass die Brahmanischen Kreise, 
aus denen er stammt, wohl grossentheils aus Conservativismus, die 
Viehzucht gegenüber dem Ackerbau begünstigen. Erst spät schafft 



T3 






Cl 



I CO 
O o 



CO 



sich der letztere im Opferritual einen Platz, überhaupt aber keinen 
in der Währungsfrage, da selbst in spätester Zeit die Honorare in 






Kühen ausgezahlt zu werden pflegen. Die ackerbautreibenden Völker 
waren nicht-arisch. Dementsprechend ist der König im Gegensatz 
zum Brahmanen Feind der Kühe, d. h. der Viehzucht und Vertreter 
des Ackerbaus. Bei einer Verherrlichung des letzteren verlassen 



cn 



Sita ihr episches, volksthümliches Element erweisen können, so wird 



wir also unbedingt den vedischen Boden. Wenn wir nun auch für 

der Schluss zwingend, dass das Rämayana in seiner Grundidee un- 

E-e 

E =3 

CO O) 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 
O Q_ 



Eine epische Idee im Veda. 229 

vedisch ist und dass, wenn wir diese trotzdem im Veda wiederfinden, 
wir in ihr einen epischen Keim erkennen, um den sich eine grosse 
Anzahl mythologischer, dem Veda fremder Ideen concentriert haben 
kann. 

Was nun die Sita betrifft, so ist es klar, dass ihr Kult, der 
seiner Natur nach ein Localkult sein musste, dem Bestreben des 
Brahmanismus, die localen Gegensätze zu uniformieren, grundsätzlich 
widersprach. Er musste also schon deshalb rein volksthümlich sein. 
Dazu kommt die Thatsache, dass in dem indischen Volke eine dem 
Brahmanismus völlig fremde Scheu vor Verletzung der heiligen Erde 
herrscht und diese fast abergläubische Furcht mit ziemlicher Sicher- 
heit auf die anthropomorphe Vorstellung von derselben zurückgeführt 
werden kann. Die Anthropomorphisierung erweist sich auch hier 
wieder als das beste Indicium für die Volkstümlichkeit jener Vor- 
stellungen. Ein ungewöhnlich günstiger Zufall gestattet uns, die Sita 
vor unseren Augen entstehen zu sehen. 

Ein Anhang zum Atharvaveda beschreibt uns ihr Hervorgehen 
aus der Ackererde: sie trägt alle Kennzeichen einer weiblichen in- 
dischen Schönheit, Für uns ist es nun von grösster Wichtigkeit zu 
konstatieren, dass der Atharv. V. in seinem Parigista, d. h. in einem 
Text, der doch jedenfalls eine Reihe von Jahrhunderten älter ist 
als das Rämäyana, sowohl Name wie Gestalt der Sita ganz im spä- 
teren Sinne kennt, während mit einer einzigen noch zu erwähnenden 
Ausnahme (die wohl nur scheinbar ist) der ganze Veda des Namens 
geschweigt. Von diesem Text nun hat bereits an wiederholten Stellen 



T3 






■o 

Q. 



i fD 
O o 



(T3 



Weber erwiesen, dass derselbe dem orthodoxen Brahmanismus ab- 
hold und mehr den volkstümlichen Auffassungen zugeneigt ist. Es 
ist hier nicht der Ort, diese Vermuthungen noch weiter zu bekräf- 
tigen. Die Thatsachen aber, dass die begünstigten Sängerdynastieen 

° N 

des A. V. von den übrigen Vedas so wenig wie der ganze Kanon 
anerkannt worden sind, dass dessen Inhalt die königliche Gewalt 



'01 

Ü =5 



cn 



=> O 



gegenüber der priesterlichen zu betonen liebt, dass er sich mit dem 

ru 



volkstümlichen Aberglauben statt dem steifen Brahmanismus be- 

schäftigt, dass endlich ganz weltliche Lieder in ihm eine Stelle haben, 

16* 

o c 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



230 Julius v. Negblbin. 

erweist Weber's Behauptung als richtig. Demgemäss müssen wir aus 
demselben volksthümlichen Texte, welcher die Sita vor unseren 
Augen entstehen lässt, das volksthümliche Verbot ihrer frevent- 
lichen Verwundung zu entnehmen versuchen. Und wirklich bietet 
A. V. 6, 116, 1 eine Entsühnungsformel für die Pflüger, welche aus Un- 
wissenheit einen Riss in die Erde machen, sie dadurch verwundend. 
Ganz dem entsprechend musste nach einer Bestimmung des Rituals 
die heilige Erde nach ihrer rituellen Pflügung besänftigt werden 
(ygawi), d. h. man verdeckte ihre Wunden. Nach K Q S 15, 8, 29 f. 
darf der gesalbte König die Erde ein Jahr lang überhaupt nicht 
betreten, sein Leben lang aber nicht ohne Sandalen auf ihr wandeln 
(cf. Q B 5, 5, 3, 7). Eine Deprecationsformel bei der Königsweihe 1 
lautet: ,Möge die Mutter Erde mich nicht verwunden, möge ich die 
Mutter Erde nicht verwunden/ Namentlich ist aber eine Ait. Br. 
8, 21 = Q B 13, 7, 1 7 15 erhaltene Gäthä- Strophe für uns lehrreich. 
Schon durch ihr Versmass kennzeichnet sie sich als eine nicht in 
den eigentlichen Veda gehörige Parthie. Sie wurde als profan em- 
pfunden und behandelt, denn das Q B a. a. O. hat den Text bereits 
verderbt überliefert, — ein bei den Manträni ganz undenkbarer Fall. 
In dieser Gäthä verweigert nun die Erde dem König Vi9vakarman 
Bhauvana, welcher sie dem Priester Ka9yapa verschenken will, den 
Gehorsam : 

,Kein Sterblicher darf mich verschenken, o Vi9vakarman Bhau- 
vana, thöricht warst Du, ich werde mitten ins Meer eintauchen und 
° E 

dann ist dein dem Ka9yapa gegebenes Versprechen gegenstandslos 
geworden/ 

Wie hochinteressant ein solcher Ansatz zur epischen Dichtkunst 
mitten in den Theorieen des Veda ist, will ich übergehen. Erwähnt 
sei es nur, dass Q B a. a. O. unmittelbar auf diesen echt epischen 
Protest gegen pfäffische Habgier, — denn was hätte dem Brahmanen 
ferner liegen müssen, als das Verbot die ganze Welt in seine Hände 



Q. O) 



_N 
'-I-J 
'Ol 

> v 



z> 



zu bekommen — die Bestimmung folgen lässt, dass die Priester als 

CO 

5 S 

ru ■£ 

1 V S 10, 23. 

.E -o 
-ö v 

E => 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original fronn 






Eine epische Idee im Veda. 231 

Opferhonorar beim Rossopfer alle vier Weltgegenden einstecken sollen. 
So hat es die Ironie des Schicksals gewollt, dass der Compilator des 
13. Buches des QB vermöge eines alten ihm unverständlich ge- 
wordenen Verses das bekämpft, was er sich selbst unmittelbar nachher 
zubilligt. Für uns aber ist neben der dualistischen Herkunft dieser 
beiden Quellen namentlich die Thatsache, dass auch hier wieder die 
Erde als lebendes Wesen auftritt, von Bedeutung. Die in dieser 
Gäthä sich findende Vorstellung ist mit der Sitä-Idee selbstverständ- 
lich nicht identisch, wohl aber nahe verwandt. Wie weit sie von 
der brahmanischen Auffassungsweise der Erde als kosmischem Ob- 
ject entfernt ist, wird später anzudeuten sein. Jetzt aber ist es un- 
sere Aufgabe, die Verkörperung der Sitä-Idee nicht minder wie 
diese selbst als volksthümlich, oder zum wenigsten als episch zu er- 
weisen, um unserer Construction einer volksthümlichen Dichtungsart 
mitten im Veda den Boden zu bereiten. Zwei Haupteigenthümlich- 
keiten haben wir bei der Sita festzustellen: ihre spontane Geburt 
aus dem Ackerboden und ihre ungewöhnliche Schönheit. Beide 
kennzeichnen sie als eine den Nymphen oder Apsarasen verwandte 
Erscheinung. Die Volkstümlichkeit der Nymphenidee hat nun schon 
Holtzmann in seinem Aufsatz in der ZDMG. Band 33 erwiesen, in- 
dem er darthat, dass die ursprünglich dem Mahäb. sehr geläufige 
Apsaras -Vorstellung mit zunehmender Brahmanisierung des grossen 
Epos Schritt für Schritt verdunkelt wurde. Damit fällt die charak- 
teristische Polemik des Veda gegen das Weib und seinen Beruf, der 
immer so tief wie möglich gestellt wird, zusammen. Dem indischen 
Brahmanen, der mehr als irgend ein Europäer zwischen Sinnenglück 
und Seelenfrieden schwankte, blieb in dieser Tendenz, die sich gern 
mit der einseitigen Betonung des Sexuellen beim Weibe verband, 
ein Prophylacticum gegen die zerstreuenden Anforderungen des prak- 
tischen Lebens erhalten. Erst dieser Gesichtspunkt ermöglicht ein 
Verständniss der Thatsache, dass der ganze alte R. V. den Namen 



T3 






w i 

fN CO 

f\l ^ 

, O) 

° m 

m - 

o 5 

c v> 

o E 



(T3 



= 1 

F P. 



u 

«4- ~° 

O <L> 

N 



> <U 

der Apsarasah nur an einer einzigen Stelle, nämlich 7, 33, 8 (und 12) 

CO 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



erwähnt, während die Vorstellung derselben bereits von Kuhn, Herab- 
kunft des Feuers und Göttertrankes, als indogermanisch erwiesen 



Original fronn 



232 Julius v. Negelbin. 

ist. — Die Ausführung dieses Gedankens muss zum Erweis der Zu- 
gehörigkeit der Sitä-Idee zu den Nymphen -Vorstellungen als einem 
durchaus unbrahmanischen Ideenzweige führen. Dazu kommen noch 
Einzelheiten. 

Das Wort urvarä ist nach MB 13, 1424 zugleich der Name 
einer Apsaras; urvarä ist Saatfeld. Ferner erwähne ich die Ksetra- 
patnl, die Herrin des Saatfeldes, im Atharvaveda 2, 12, 1. Unwill- 
kürlich denken wir an die Mittagsfrau unserer Sagen. Von beson- 
derer Wichtigkeit für die Identificierung der Sita mit den Nymphen 
ist ausser dem Moment der Schönheit der letzteren — vgl. die Nym- 
phen-Namen: Sulocanä, Suvrttä, Suratä, Surüpä, Somä, Vapus, Su- 
ke§I, Sugandhä, Sugrlvl, Sumukhi, Anavadyä, Kar^ikä, 
Kämyä, Ke^ni, Laksanä, Lata, Vaö9ä, Subähu, Subhagä, Gupävarä, 
Gunamukhyä, Caruneträ, Dancjagauri, Anünä, Alambusä, Puncjarlkä, 
Madhurasvarä, Mi9rake9l — die Thatsache, dass die spontane 
Zeugung zu den ganz wesentlichen, hochbedeutsamen Charakteri- 
stiken der Apsaras gehört. Freilich kenne ich nicht einen einzigen 
Fall, in dem ein vedischer oder epischer Text von der Geburt einer 
Nymphe redete. Vielmehr scheinen diese von Uranfang an dem in- 
dischen Pantheon angehört zu haben. Doch war es des Dichters 
jener A. V. P.- Stelle freies Recht, ihre Geburt, oder vielmehr nur 
ihr lokales In -die -Erscheinung -Treten nach Analogie der im Volke 
lebenden Vorstellung von dem Modus ihrer eignen Zeugung darzu- 
stellen. Wie eng wir damit den einheimischen Sagenkreis berühren, 
brauche ich nicht besonders zu betonen. Die Wassergeister, die 



ö. u 
.c o 






w i 

fN CO 

O u 



o o 

c v> 
o E 



(T3 



Wasserkuh, die weissen Frauen, die Wichtelmännchen, das Wiese- 
wittel steigen von selber vor unserem Auge auf. Das Volk will 



F P. 



seine Götter eben sehen und fassen können, ja es will oft noch 
mehr; mit verschleiernden Symbolen ist ihm nicht gedient. Die 



O <L> 



Nymphen des Ackerbaus und des Wassers bedingen also keinen 
Unterschied in dieser Hinsicht. — Damit scheidet aber Sita aus dem 
Kreise der vedischen Vorstellungen aus. 



> <u 

C CT 

=) O 

— o 



Die Lehre von der spontanen Zeugung der Apsaras, zu der 
wir uns als einem weiteren Kennzeichen der Sita -Idee nunmehr 

£ ~o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Eine epische Idee im Veda. 233 

wenden, lässt sich aus verschiedenen Stücken des Veda und des 
Epos als richtig erweisen. Hierher gehört vor allem eine von Roth 
im P. W. gänzlich mis verstandene, von Geldner in den vedischen 
Studien 1, 260 verbesserte R. V.-Stelle ; nämlich R. V. 7, 33, 11. Roth 
übersetzt sie: ,Du bist ein Mitra-Varuiia-Sohn, o Vasistha, geboren, 
o Brahman, aus des Gemüthes (der beiden Götter, ohne Zuthun 
eines Weibes) brünstigem Verlangen; den durch göttliche Zauber- 
kraft entsprungenen Tropfen (Funken) fassten dich alle Götter in die 
Schale auf/ — Roth hat also eine Flamme der Begeisterung aus 
dem Kopfe des Götterpaares schlagen und dieselbe in einer Schale 
von den vi9ve deväh aufgefangen gesehen. 1 Vasisfha wäre danach 
lediglich das Product der religiösen Erregung der Götterzwillinge. 
Der wahre Sinn der Stelle ist aber ein viel prosaischerer. — Urva9l 
ist nämlich Eigenname und als Genetivus objectivus abhängig von 
manasas. Wir haben also zu übersetzen : ,Du bist, o Vasisjha, aus 
dem Verlangen nach der Urva9i entsprungen/ Was heisst das? Wer 
war die Urva9i und woher kam das Verlangen der Götter nach ihr? 
Das Mahäbhärata beantwortet diese Fragen. Miträvaruna wandelte 
nach ihm einstmals auf Erden; da sah er die schöne Apsaras Urva9l 
und nun passierte das, was selbst den Göttern des heissblütigen 
indischen Volkes passieren kann. Das herabgefallene semen virile 
wird in einem Kruge aufgefangen und aus ihm entwickelt sich Va- 
sistha. 2 Ausser Vasisjha kennt bereits der Veda die Gestalt des 

° q 

Agastya als von dem gleichen Process herrührend. Späte Texte wie 

das Bhägav. P. 6, 18, 5 nennen beide Rsi als Kinder des Miträva- 

ruija neben einander. 3 Dass aber dem Agastya die Priorität ge- 
E I 

- "r? 

F P- 



■ö 









w i 

fN CO 

O u 



U 

«4- ~° 



<u 



TD 



1 Gleich missverständlich bei Oldenberg, ZDMG. 39, 74. 

* Holtzmann, ZDMG. 34, 689 verkennt den Inhalt der Sage so vollständig, 
dass er als Vater des Agastya (des epischen Stellvertreters für Vasi§tha) Mitra oder 
(!) Varuna nennt — putra Miträvarunayos, cf. M B 12, 208, 29 = 7595 || 13, 166, 40 



= 7666 || 151, 35 = 7113, cf. 3, 103, 14 = 8776 und hinzusetzt: ,Seine (Agastyas) 
Mutter ist im M B nirgends angegeben.' Miträvaruna war eben eine Zweieinigkeit 
wie die acvin. 

8 Für die spätere Zeit gilt Vasistha allgemein als der Vertreter des ortho- 
doxen Brahmanismus, dem mau diese merkwürdige Art der Entstehung zuschreibt: 
'-o v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 



Ö. ^ 



Cl 



03 






(T3 



$ 5 



F P. 



234 Julius v. Negelbin. 

bührt, ist unzweifelhaft und auch von Holtzmann u. a. bereits er- 
kannt worden. Das Verhältniss beider zu einander wird sofort klar, 
sobald man unter Beobachtung der oben entwickelten Gesichtspunkte 
sich vergegenwärtigt, dass Agastya den alten Volkstraditionen, also 
dem Ahnenkult, Vasis^ha dagegen den vedischen Sängerschulen an- 
gehörte. Es bedurfte einer ganzen Anzahl von brahmanischen Ge- 
nerationen, um diese Thatsache soweit zu überkleistern, dass man 
den in der VolksaufFassung und im Epos lebendig bleibenden Agas- 
tya zu einem frommen Brahmanen stempelte, ohne indess die kraft- 
vollen epischen Züge verwischen zu können, die ihm nun einmal 
angeboren sind. 1 Da hören wir von seiner riesenhaften Leistungs- 
fähigkeit im Trinken, die es ihm nicht nur möglich macht, das ganze 
Weltmeer zu verschlingen, sondern auch gleich dem Thor der ger- 
manischen Sage (cf. Gylfaginning 46) mit grosser Geschwindigkeit 
zu verdauen, cf. Holtzmann, ZDMG. 34, 591 ff. Wer dächte da nicht 
an die, z. B. von Weinhold, Die Riesen des germanischen Mythus, 
p. 72, hervorgehobene Fresslust der Yötun, wer nicht bei Erwähnung 
des Riesen Wolfesmäge und seiner Verwandten des indischen vyko- 
dara? Solche Parallelen erscheinen als dunkle Kunde aus einer un- 
vordenklichen, dem Brahmanismus vielleicht viele Jahrtausende vor- 
ausgehenden Zeit mir von der höchsten Bedeutung. — Für die Zu- 
gehörigkeit des Agastya zum Kreise der Volksmythen sprechen über- 
diess seine Beziehungen zu Räma, dem Sohn des Jamadagni (M B 
13, 84, 38 = 3968), einem ausgesprochenen A. V.-ßsi und zu Bhj-gu, 
der sich in dessen Haarzopf verbirgt (MB 13, 100, 14 = 4785) 



iE ^ 

MB 13, 7372: sa (krpnah) kumbharetah sasrje suräriäm yatra utpannam rsim ähur 
vasiftham. 

1 Cf. Holtzmann, ZDMG. 34, 596: Die spätere Zeit hat jene ersten Apostel 
arischer Kultur zu Büssern und Heiligen gemacht, aber es müssen mannhafte und 
thatkräftige Menschen, harte Krieger und kühne Jäger gewesen sein, die sich mitten 
unter die wilden Feinde wagten und gerade Agastya, der berühmte Jäger und Bogen- 
held, den gleich dem Heracles im Essen, im Trinken und im Verdauen keiner er- 
reichte, dessen derbes Naturell noch durch alle Entstellungen der alten Sage hie- 
durch kenntlich ist, war ein Heiliger etwa von dem Schlage des Waldbruders im 

Ivanhoe. 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Eine epische Idee im Veda. 235 

sowie die Thatsache, dass das Austrinken des Meeres, welches nach 
MB 3, 103, 6 = 8768 und 1, 188, 15 = 7047 dem Agastya zu- 
kommt, in späten Partieen des MB (nämlich 13 ? 154, 3 = 7215) 
auf den ganz speciellen Atharva-]Jsi Atigiras übertragen wird. Zum 
Beleg für das Alter der Agastya- Sage diene noch die Thatsache, 
dass nach MB 3, 130, 6 = 10541 Agastya am Indus, also an den 
vedi sehen Sitzen der Arier, localisiert erscheint. So schliesst sich 
Glied für Glied zu dem Beweise zusammen, dass der ur-orthodox- 

brahmanische Vasisjha die Herrlichkeit seines spontanen Ursprungs 
ru- 
dern immer volksthümlich bleibenden Agastya zu verdanken hat. 

Dafür spricht auch noch die im Epos erwähnte Abstammung des- 
selben von Pulastya, mithin seine Descendenz von dem (lediglich 

o 

epischen) männlichen Brahman und seine (Manu 5, 22 erwähnte) 
Erlaubniss der Thiertötung, welche den brahmanischen Theorieen 

tu 

schnurstracks wiederspricht, nicht minder auch die A. V. 4, 37, 1 ge- 
thane Erwähnung, dass Agastya mit einem Kraut (also ein echter 
Volks -Heil -Künstler!) die raksas (bösen Geister) erschlagen habe. 
Danach kann es nicht wunderbar erscheinen, dass er, der alte Volks- 
gott, in der R. V.-Auflfassung charakteristischer Weise als Fürbitter 
auftretend, einem Verunglückten sogar zu einem ehernen Bein ver- 
hilft (R. V. i, 117, 11). In diesen echt volkstümlichen Sagenkreis 
passt die Erzählung von Agastya's Zeugung nun deshalb ganz treff- 
lich herein, weil sie ja die Incarnation des Miträvaruna voraussetzt 
und damit an das epische Vagantenthum der Götter gemahnt. Diese 
Agastya-Zeugung wird nun auffällig oft berührt. Das Varäha-Bräh- 
mana, S. 12, 13 nennt den Agastya varunäögaruha, das Mahäbh. 
3, 98, 2 = 8596, cf. 12, 342, 51 = 13216 kumbhayoni, Hemacandra 
ghatodbhava; cf. ghatodara, ghatäbha im P. W. (ghatayoni ibid.)] die 
Zeugungsidee muss also in diesem Mythus eine grosse Rolle ge- 
spielt haben. Nun lehrt das P. W. den Namen des Agastya auch 
als den einer Pflanze kennen. Nun ist es ersichtlich, dass die Apsa- 
ras, zu denen Urva9l (als die Heldin des Agastya -Mythus) ja ge- 
hört, ihre Namen auf Pflanzen übertragen haben, dass wir es also 
bei den indischen Nymphen, auf die wir diesen Zeugungsmodus zu 

.E -ö 
-ö v 

E-e 






w i 

fN CO 

O u 






o E 



(T3 



§ S 



=) O 

— o 



fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



236 Julius v. Negelein. 

generalisieren haben/ mit den Blumenmädchen oder Mädchenblumen 
der germanischen Sage zu thun haben, 2 der sich aufs engste die uns 
jetzt erst verständliche Sagara-Geschichte des Rämäyaria anschliesst 
Die 60000 in Krügen entstandenen Söhne des Sagara sind ein Sym- 
bol der ungeheuren Zeugungskraft des Meeres. Selbst eine Zeit, 
welche bereits die letzte Fühlung mit der natursymbolischen Be- 
deutung der Sage verloren hatte, hielt die Eigenthümlichkeit jenes 
Zeugungsmodus fest. 3 Die Vorstellungen von dem Laichen unserer 
Nixen, die zahllosen Sagen von der Vermählung derselben mit irdi- 
schen Männern und dem treulosen Verlassen ihrer Geburten (cf. 
Laistner, Räthsel der Sphinx, Schmidt, Volksleben der Neugriechen 
115 ff.) gehören hierher. Dadurch gewinnen wir den Bezug des 
Nymphen-Glaubens zu der Verehrung der Wasserthiere überhaupt, 
wovon die deutschen Nixen, welche fischschwänzig und stumm wie 
die Fische sind (cf. die Erzählung bei Schmidt a. a. O.), ein eben so 
beredtes Zeugniss ablegen wie die Verzauberung der Apsaras durch 
Rsi in Krokodilgestalt und die Geburt des Matsya (d. h. Fisch) durch 
eine Nymphe, welche Fischgestalt angenommen hatte (MB 1, 2393), 
oder die haösa-Manifestation derselben in der Purüravas-Urvagi-Tra- 
gödie des 5-gveda, was wieder an unsere Schwanenjungfrauen er- 
innert. 

Die vorausgegangenen Andeutungen werden genügen, um den 
Erweis als erbracht hinzustellen, dass sämmtliche charakteristischen 
Merkmale der Sltä-Idee sammt einer ganzen Fülle nahe verwandter 
Vorstellungen als volksthümlich und unvedisch zu betrachten sind. 
Um aber den gemeinschaftlichen Ideenkreis noch enger zu ziehen, 
will ich im Anschluss an den letzten Theil unserer Betrachtung den 

fD ^ 

1 Eine Apsaras heisst Kumbhayoni MB 3, 1785, verschiedene Pflanzen heissen 
Kumbhalä, Kumbhavljaka, Kumbhikä, Kumbhinlvlja, Kumbhipäkl, Kumbhika. 

2 Noch im heutigen Indien geniesst eine Blume, Premsuderi, deren Namen 
aucli Mädchen beigelegt wird, göttliche Verehrung. 

3 Purüravas in Kälidäsas Drama spricht seine Verwunderung darüber aus, 

Z) o 

dass die Entbindung der Urvacl plötzlich, ohne die Symptome der Schwangerschaft, 
erfolgt sei. Das liegt auf gleichem Boden. Urvaci, Str. 146, Pischel und Geldner, 
Vedische Studien 1, 271. 



t! öi 



TS 



03 



03 

ifl tn 

£ -o 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Eine epische Idee im Veda. 237 

Hinweis geben, dass eine der Sltä-Entstehung ganz analoge Apsaras- 
Zeugung aus dem Veda zu erweisen ist. Es handelt sich um die 
(z. B. auch bei Oldenberg, Religion des Veda beinahe übergangene) 
Göttin i(Jä, welche, der irrigen Auffassung des Pet. W. zuwider, QB 
1, 8, 1, 7 vor Manu's Augen entstand, indem sie mitten aus dem 
Wasser emporsteigend, sich quasi auf ihre Füsse stellte. 1 Sie be- 
steht vollständig aus Butter, Butter trieft auch von ihrem Gewände 
herab. Wenn wir uns nun gegenwärtig halten, dass Manu der Vater 
des Opfers, d. h. der erste Veda-Theologe ist, so wird alles von selbst 
klar, sobald wir den vorgeschlagenen Erklärungsmodus acceptiercn. 
Manu als Theologe konnte nach vollständiger Uebersetzung der 
Sage ins Brahmanische eben auch nur eine theologisch aufgefasste 

o 

Nymphe zur Tochter haben. Denn dass wir in der idä thatsächlich 
eine Nymphe zu sehen haben, erhellt nicht nur aus dem charakte- 
ristischen Zeugungsmodus, sondern auch aus der Thatsache, dass 
eine irä im Mahäbh. 2, 393 als Apsaras und (charakteristischer 
Weise!) als Mutter der Blumen vorkommt. 2 Das Wasser, aus dem 
die epische Apsaras entstehen würde, ist in das brahmanische Le- 
bens-Elixir, die Opferbutter (ghrta) travestiert. Wenn deshalb R. V. 



(T3 



2 5 



Ifl 



1 y pibd so zu übersetzen ! pibd = api + päd. Nach späterer Doctrin geht, 
der ida ganz analog, bei der Butternng des Oceans in buttergelbem Gewände 
des Segens Göttin £n hervor. Wie idä butterfüssig, ist die Meerentstiegene Thetis 

o u 

silberfüssig : A 538 es handelt sich wohl um die Darstellung des Elements (der 
Butter oder des Meeresschaums), dem beide ihren Ursprung verdanken. Irsl gilt 
als Frau des Ka^yapa und Tochter des Daksa in einem späteren Texte (cf. Pet. \V.) 



Die brahmanische Speculation aber macht sie später zu einer Trägerin des Sub- 
stanzbegriffs. Auch darin ist die Analogie mit den Apsaras als den Wassern, in 
deren Gebilde alles organische Leben schliesslich eingeht, wie es daraus hervor- 
kommt, unverkennbar. Zunächst wird deshalb die Idä (wir würden das Wort am 
besten mit ,Nährstoff c übersetzen) yuthasya matä genannt, und tritt später als Kuh 
auf: Rgveda 5, 41, 19, V. S. 8, 43. Grhyasamgrahaparicjstha kennt Idä unter den 



Worten für Kuh und Tait. Samh. sagt 1, 7, 1, 1 = pacavo vai ida. Doch hat der- 
selbe Text in der Unterredung zwischen Sam^ravas Sauvarcanasas mit Tumiriija 

=) o 

•*-* o 

betriff zu entdecken 

"ÖJ 



Aupoditi (1, 7, 2) den ersten Versuch aufbewahrt, in dem Worte ida den Substanz- 



2 A. V. 10, 4, 24 kennt ghrtäcl als NPr. einer Blume, welche kanya ange- 

redet wird. Cf. dazu ambe ambäle ambike, Anrede der mahisi beim a^vamedha. 

.E "o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



238 Julius v. Negelein. 

7, 16, 8 die i(Jä ghrtahastä heisst, 1 wenn T. S. 1, 2, 5, 1 = R. V. 10, 
70, 8 und oft von dem ghfta-reichen Fusse der i<Jä spricht (idäyäh 
pade ghrtavati sväha), so sehen wir vor unseren Augen die ein- 
zelnen Glieder eines Sagengebildes entstehen, welches für uns die 
Kette der Beweise schliesst, dass der Sltä-Roman bis in seine Ein- 
zelheiten hinein als episches Motiv im Veda vorgebildet liegt. Wir 
haben zu diesem Beweise den Weg gewählt, die Geschichte der Sltä- 
Idee zu verfolgen. Zu dem gleichen Resultat führt schliesslich auch 
die Thatsache des Liebesverhältnisses zwischen dem Heroen und 
der Nymphe, das auf das uralte Zusammenleben zwischen Göttinnen 
und Menschen weist, wie dasselbe sich überall wiederholt (Numa 
Pompilius mit der Egeria, die Mährten -Ehen, Odysseus und Kaly- 
pso, Vicjvämitra und Menakä u. s. w.). Eine andere Methode müsste 
die Sprache dieser Gäthä/s untersuchen und durch Constatierung dia- 
betischer Varianten die Brücke zwischen Veda und Epos schlagen. 
Wir haben uns einstweilen damit zu begnügen, die Geschichte einer 
einzelnen Idee dieser weiten Ideenreihe zu durchforschen und wollen 
jetzt dazu schreiten, deren specielle Localisierung und Ausgestaltung 
soweit wie möglich zur ückzu verfolgen. 

Von den Gäthäs ausgehend, welche namentlich im Rämäy; 1, 1, 
86 — 93 und 6, 113, 1 — 11 als constanter Faktor unter den zahllosen 
Textvariationen bereits Weber aufgefallen sind, bemerken wir, dass, 
wenn wir die von Weber in den Text gesetzten Worte jener Stro- 
phen streichen und die gestrichenen hineinsetzen, wir zu Versen ge- 
langen, welche den vedischen Gäthäs ganz ähnlich sind — ähnlich 
nicht nur ihrem Versmass und ihren grammaticalischen Eigenthüm- 
lichkeiten, sondern auch ihrem Inhalt nach. Sie preisen die glück- 
liche Regierung Rämas und finden sich ihrem Inhalt nach ziemlich 



t! öi 



Cl 



03 



F ö. 



u 

«4- ~° 

o ö) 

1 Cf. ghrtasthalä als NPr. einer Apsaras, sowie die Angabe, dass Urvaci nur 

einige Tropfen ghrta als Speise genossen hat, was auf Butterlibationen zurück- 
gehen muss, welche derselben gebracht sind. R. V. 2, 35, 14 spricht von den äpas 

3 o 

naptre ghrtam annam vahantik. Charakteristischer noch ist A. V. 7, 109, 2 f., wo 
umgekehrt der Blitz aufgefordert wird, die Wasser zu bedienen: ghrtam apsarä- 

bhyo vaha tvam agne pämunak$ehhyah sikata apagca. 

£ -o 
-o v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Eine epische Idee im Veda. 239 

unverändert, aber natürlich in Prosa aufgelöst, im Qatapathabräh- 
mana wieder, wenn dieses im A9vamedhakän<Ja das Lob der recht- 
handelnden Könige der Vorzeit zu singen befiehlt. Der wichtige 
Unterschied zwischen der vedischen Stelle und der epischen besteht 
aber darin, dass der Veda-Text den Preis der Regierungszeit seines 
Königs nicht auf die Person Räma's beschränkt hat, vielmehr nur 
ein allgemeines Schema aufstellt, welches in seiner festgewordenen 
Form die Vermuthung eines alten Ursprungs aufkommen lässt. Die 
Ehe zwischen Räma und Sita, deren Preis hier vor uns liegt, ist 
also nichts anderes als ein formelhaftes Schema für einen Gesang, 
den als episch zu erweisen die ganze vorausgegangene Betrachtung 
diente. Danach bleibt nur die Möglichkeit übrig, zu vermuthen, 
dass die Persönlichkeit des Räma, die den Kernbestand der Sage 
nicht berührt, verschiebbar, die der Sita aber, als der Sage wesent- 
lich, constant ist. Diese Vermuthung wird nun in überraschender 
Weise durch die Thatsache bestätigt, dass der Atharva- sowie der 
Jtgveda im zehnten Buch und andere Texte 1 einen König Prthu 
Vainya erwähnen, welcher die Erde melkte; er melkte aus ihr den 
Ertrag des Feldbaus und des Grasbaus, darum leben die Menschen 
von dem Ertrag des Feldbaus und des Grasbaus. Noch Kälidäsa 
nennt die Erde in seinem Kumärasambhava P^thüpadistä. 2 Die Idee 
muss also tief eingewurzelt gewesen sein. Wer war nun dieser Prthu? 
Schon Ludwig, 5-gveda 3, 145 erkennt seinen Namen als ,nur all- 
gemein typisch'. Und doch muss er ein König und, wenigstens nach 
der Veda-Tradition, eine historische Persönlichkeit gewesen sein. Als 
Eigenname kommt er sonst nicht vor. Es ist daher namentlich an- 
gesichts des Umstandes, dass er also ein blos ad hoc erfundenes 

|f 

ro ^ 
U 

O <L> 

>>£ 

Rama-Idee in der Sitä-Vorstellung zu thun haben. Zu der Acker- 

> cu 



3 o 

1 R. V. i, 112, 15 x 148, 5: CB 5, 3, 5, 4; K. 37, 4; A. V. 8, 10, 24; R. V. 
x, 171. 

2 Nach Ludwig, Mantral. 167. 

'■o £ 

E-e 

E =3 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

C _Q 

ü Q_ 



V öl 



<3- 



w i 

fN CO 

f\l ^ 

° m 

ro ^ 



Masculinum zu Prthivi, dem Worte für Erde, ist, unzweifelhaft, dass 
wir es bei ihm mit nichts anderem als dem ideellen Träger der 



240 Julius v. Negelbin. 

erde, dem bebaubaren Lande, als Weib, als Prthivi oder Sita, tritt 
eben der jedesmalige P^thu oder Räma als das männliche Princip. 
Dass der letztere zum Erzeuger gerade des Getreidebaus gemacht 
wird, ist für die Identificierung unserer Sage mit den behandelten 
Sagengebilden von entscheidender Wichtigkeit. Aus den alten Theilen 
des IJgveda wüsste ich nicht einen einzigen Beleg der Sita -Idee 
in dieser seiner strengen Form beizubringen. Das ist für die Be- 
urtheilung dieses Textes, der erst Schritt für Schritt zu immer 
weiteren Concessionen an die Volksauffassung gezwungen wurde, 
recht wesentlich. Dagegen kennt M S 4, 3, 1 * die Erde bereits als 
Ksetrasya patnl, d. h. dem Femininum zu Ksetrapati, dem Gemahl 
der Ackererde. Den Ksetrasya pati 2 erwähnt bereits der Rgveda 
(cf. oben). Die Stellen sind wenig charakteristisch und lassen die 
Uebersetzung als genius loci zu, jedenfalls aber das sexuelle Ele- 
ment schon hier in die Auffassung hinein verwebend. Doch hoffen 
wir einen weit sichereren Anhalt für das hohe Alter der Sitä-Idee 
und des Sitä-Gesanges finden zu können. 

Wir sprachen von einem Pj'thu Vainya. Woher der Beiname 
Vainya? Das P. W. liest das Wort mit dentalem n und erklärt die 
Schreibweise mit cerebralem n für falsch. Doch ist ein Vena nur 
schlecht bezeugt und zeigt die entsprechende Variante. Wenn wir 

in 

also ein Vainya mit cerebralem n in den Text setzen, so ist der 

u 

Name, wie man diess von einem blos fingierten N. Pr. mit leicht er- 
klärbarem Vornamen verlangen muss, gut etymologisierbar und er- 
öffnet eine weite Perspective: denn Vainya ist eine Adjectivbildung 
zu vlnä und heisst also: zur Laute gehörig. Was bedeutet diess? 
Weber in seinen Arbeiten: ,Ueber die indische Königsweihe' und 
über: ,Episches im vedischen Ritual' belehrt uns darüber, dass bei 
mehreren Gelegenheiten welche dem Könige im Gegensatz zu dem 
Priesterstande die erste Rolle zuweisen, also namentlich bei seiner 
Krönung und dem grossen Rossopfer, eine erhebliche Anzahl rein 



■o 






O o 



(T3 



CD 



=> O 

— O 

CO 

'cd <£ 



<£ CD 

1 Bei Weber, Rajas, 12 Anm. 3. 



* Kau§-Brähm. 30, 11. Käth. 9, 17: 24, 10; 26, 1. 



LH lo 

£ -o 
-ö v 

E-e 

E =3 

fD CD 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
CD zj 
O Q_ 



Original from 



Eine epische Idee im Veda. 241 

volkstümlicher, im Veda sonst nicht auffindbarer Gebräuche und 
Anschauungen, zu Tage tritt, welche zu den rein brahmanischen 
Opfern das Gegenstück bieten. In die Lebensauffassung des Krieger- 
standes, in seine Sitten gewinnen wir einen trefflichen Einblick, wenn 
wir von den Kriegszügen, welche jährlich von neuem unternommen 
werden sollen, von der gewohnheitsmässigen Wegräumung der ge- 
fährlichen Anverwandten des Königs, von seiner Vorliebe für das 
Würfelspiel und den Arrac, nicht minder aber für die Weiber und 
für Zoten hören. In diesen Kreis nun gehört ein Gesang, bedeut- 
samer Weise nicht von Brahmanen, in deren Händen doch das Opfer 
ausschliesslich lag, sondern als Duett von einem Krieger und einem 
Brahmanen gesungen, also unvedischer Natur. Dieser Gesang ist 
dazu bestimmt, der Aufforderung des Adhvaryu-Priesters Genüge zu 
leisten, den Opferherrn mit den guthandelnden Königen der Vorzeit 
zusammen zu preisen. 1 Man sieht, dass es sich hier um ein reines 
Puräna-Motiv handelt, um eine Märchenerzählung, vorgetragen vor 
einem aus Laien bestehenden Publicum vonseiten eines Mannes, 
welchem die Veda-Doctrin fremd ist — denn es ist evident, dass 
das Hineindringen des Brahmanen neben dem Ksattriya in diesen 
echt volkstümlichen Theil des Pferdeopfers zu den jüngsten Theilen 
des Rituals gehört. Auch hier zeigt sich also die Vorliebe der Krieger- 
kaste für epische Motive und die engste Verwandtschaft mit der Prthu- 
Idee. Wie hier, so dort handelt es sich um Könige, deren Sänger- 
schulen durch eine mythische Genealogie den Ruhm ihres Herrn er- 
höhen sollen. Die formelhafte Kunde von einer märchenhaften Ver- 

gangenheit hat in den Sängerschulen, welche den mit Volksbelusti- 
* I 

- "r? 

F P. 



■o 






Q. 



i fD 
O o 



gungen verbundenen Opfern zu dienen berufen waren, eine Pflege- 
stätte gefunden. Die Perspective, welche sich hier eröffnet, wird 
eine weite, sobald wir erwägen, dass das Hinzuziehen jener Sänger 
zum Opfer doch eben nichts weiter als eine Concession an alte Volks- 



u 

O <L> 

*s 

sitten war: alte Märchenlust des indischen Volkes, die noch heute 

5 o 

den Fremden in Erstaunen setzen soll, findet in diesen alten An- 
co 
S S 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



1 So nach Äp. Qr. S. 6, 13. 



Original fronn 



242 Julius v. Negelein. 

gaben bereits einen einzelnen Reflex. Zweifellos genossen also der- 
artige Erzählungen, obwohl ursprünglich mehr Hof- als Volkspoesie, 
eine grosse Popularität. So wird das Nomen Proprium: vainya, d. h. 
der im Gesänge Fortlebende, für das Prototyp eines den Ackerbau 
schirmenden Königs oder göttergleichen Landesherrn verständlich. 
Mit der Thatsache der Popularität jener Ideen muss auch die von 
Weber, Rämäy. 56, Anm. 1 citierte Angabe des Adhyätma-Räm., 
dass Valmiki von niedriger Kaste sei, irgendwie zusammenhängen. 
Wie eng sich an diesen Ideenkreis die ungeheure Kette der persi- 
schen Tradition anknüpft, welche Firdosi in seinem Schah-Nämeh zu 
verklären verstanden hat, sei hier nur andeutungsweise erwähnt. 
Von höchster Bedeutung für unsere Zwecke wäre es dagegen, wenn 
wir die Grundlage der Sitä-Idee noch über die gewonnenen Glieder 
hinaus in einer Zeit wiederfinden könnten, welche der indo-persischen 
Gemeinschaft näher liegt, mithin einerseits in der altpersischen Tra- 
dition eine Stütze finden könnte, andererseits aber ihre Zugehörigkeit 
zu dem indischen Ideenkreise nicht verläugnete. Einen Anhalt für 
das Vorhandensein so weitreichender Beziehungen bietet nun die 
Persönlichkeit des Jama, welcher, wie schon bemerkt, den späteren 
Manu vertritt. Jama ist erster Mensch und erster König. Von ihm 
sagt Yacna 9 (cf. Roth, ZDMG. 4, 146?): ,Unter seiner Herrschaft 
hat er Herden und Männer vom Tode, Gewässer und Bäume von 
der Dürre befreit, und die Nahrungsmittel unerschöpflich gemacht. 
Während seiner ruhmreichen Herrschaft gab es weder Frost noch 
Hitze, weder Alter noch Tod, noch dämonischen Neid/ Wenn wir 
nun das von QB 13, 4, 3, 7 für den zweiten Tag des zehntägigen 
acjvamedha-Cyclus vorgeschriebene Puränam von Yama hinzunehmen 
und das Vorhandensein einer alten Sängerschule in der Avesta-Zeit 
feststellen, 1 so erweist sich Yania, der indo-arische Urregent, zugleich 
> £ — ■ 

1 Nach den Berichten der Griechen haben die Perserköuige ein ganzes Heer 

von Sängern unterhalten, und die Thaten der Helden wie das Lob der Götter vor- 

*— o 

getragen. ,Schack, Das Königsb. d. P. S. 31. Den ganzen von uns gezeichneten 

<D ^ _ „ 

Verlauf der Sltä-Käma-Idee zum Ramäyana-Epos scheint Schack vorwegzunehmen, 

wenn er a. a. O. p. 30 die Vorgeschichte des Schahnäme in folgender Weise sich 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Ö. u 
V öl 






w I 

fN CO 

f\l ^ 

, O) 

O o 



o E 



(T3 



2 5 



F P. 



Eine epische Idee im Veda. 243 

als der mythische Begründer einer epischen Schule, in deren Mittel- 
punkt natürlich seine eigne Persönlichkeit stand. Damit ist aber 
unsere Stellung zu den epischen Elementen des Veda sowie dem in- 
dischen und persischen Epos gegeben: so falsch es ist, die Gäthä- 
Poesie des Veda mit dem Veda selbst auf die gleiche Stufe zu stellen, 
so evident irreführend ist es, in ihrer im Veda uns erhaltenen, also 
durch brahmanische Hände gegangenen Form eine ungetrübte Quelle 
der Volkspoesie erkennen zu wollen. 

Zur indopersischen Urzeit zurückkehrend, können wir noch 
über dieselbe hinaus die Spuren eines epischen Gesanges, wie ich 
nur anhangsweise erwähne, vielleicht in den Händen der Centauren 
gelagert finden, vorausgesetzt, dass wir in ihnen wirklich, wie ich 
vermute, an ihre Pferde angewachsene Reitervölker zu sehen haben, 
die, in vollständiger Parallele zu kriegerischen Stämmen Indiens, 
neben der Heilkunst auch dem Gesänge, welcher wohl nur ein 
epischer gewesen sein konnte, ihre Pflege zuwandten. 

Zu unserem Ausgangspunkte zurückkehrend, stellen wir fest, 
dass die Thatsache der Pflege der Räma-Sitä-Idee durch besondere 
Sängerschuleli schon die Beantwortung der Frage in sich birgt, wer 
Räma war und warum gerade er zum Repräsentanten einer im alt- 
indischen Volksleben eine so ausserordentliche Rolle spielenden Idee 
wurde. Wir haben in ihm einen bereits in früher Zeit herrschenden 
König zu sehen, den seine Sänger etwa zum Dank für seine Frei- 
gebigkeit unsterblich gemacht haben. Diese Auffassung wird durch 
Nachrichten wie die des Harivaft9a 2352 bestätigt, nach der Pu- 
ränenkundige Leute die Thaten das Räma in gäthä-Form zu be- 
singen pflegen. 1 Aus der Anzahl der Saiten, welche die Laute ehe- 



TD 



V öl 



Cl 



.TD 






(T3 



F P. 



mals hatte, und dem Studium der gätha-Qloken wird sich auch für 
die Erkenntniss des Vortrags jener Gesänge noch vieles gewinnen 



«4- ~° 

O <L> 
TD 



i/) 



vorstellt: Rhapsoden werden die Thaten der Helden und Könige in abgerissenen 

Liedern gefeiert haben, bis aus Verbindung und Zusammenschmelzung derselben 

*— o 

mehr und mehr ein epischer Körper erwuchs.* 



1 gäthäggapyatra gäyanti ye puränavido janäh Eäme nibaddhäs tattvarthä mahä- 



tmyam tasya dhimatah 



Wiener Zeitschrift f. d. Kunde d. Morgenl. XVI. Bd. 17 



o c 
E => 

in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



244 Julius v. Negelein. 

lassen. Wenn wir endlich den Versuch der Localisierung der Räma- 
Sage machen wollen, so bietet die Thatsache, dass der Kosala-Vi- 
deha -König Janaka als Vater der Sita genannt wird, einen inter- 
essanten Anhalt. Von dem Lande der Videhas wissen wir nämlich, 
dass dasselbe ,aus einer Sumpfregion durch den Gewerbefleiss seiner 
Bewohner in einen Streifen blühenden Landes verwandelt worden 
ist'. 1 Daran knüpft sich eine Mythe, die in volksthümlicher Gestalt 
jedenfalls besagt haben wird, dass Agni, der Feuergott, in eigner 
Person dem kämpfenden Heere den Weg in dieses Land gewiesen 
hat, d. h. dass die Brandfackel des Krieges die Gegner aus einem 
Lande vertrieb, das sodann die Segnungen des Ackerbaus erfahren 
sollte. Wo konnte eher als hier die kraftvolle Regentschaft eines 
Monarchen unter dem Bilde seiner Vermählung mit der hier that- 
sächlich dem Wasser entstiegenen heiligen Ackererde eine dauernde 
Gestaltung gewinnen? Denn die heilige Ackererde ist in der That 
die Tochter von dem Repräsentanten eines Volkes gewesen, das die 
Sumpfregion des westlichen Indiens zur fruchtbaren Mutter eines 
ganzen Volkes gemacht hat. Wie jede indische Sage, so hat auch 
die Sltä-Mythe entsprechend dem Kreise, aus dem sie entsprungen, 
ihre Variationen, die, wenn wir die indische Terminologie anwenden 
wollen, als aus der adhyätman- und adhidaivatam -Auffassung ent- 
sprungen bezeichnet werden können. Die erstere, die makrokosmi- 
sehe, macht den irdischen König zum Götterkönig und das Acker- 
land zur Erde im Sinne eines kosmischen Objects, die letztere, die 
mikrokosmische, den König, d. h. den Repräsentanten einer räumlich 
und zeitlich eingeschränkten Kulturbewegung, zum empirisch auf- 
gefassten Individuum und das Ackerland, ganz dementsprechend, 
zum zeugungskräftigen menschlichen Mutterleib. Jene Auffassung 
findet sich in den Veda-Texten zum Beispiel in der Darstellung der 
Aditi, d. h. der Erdgöttin, als Visnu-patni, als Gemahlin Visnu's, cf. 
VS 29, 60, T S 4, 4, 12, 5; 7, 5, 14, 1, deutlicher noch in der 
Bezeichnung des Indra als Gemahls der urvarä, des fruchtbaren 



■o 

Q- 



(T3 



2 5 
F P. 



c (5 

CO 

■g uj 

1 Die Litteratur hierüber ist zusammengestellt bei Zimmer, Altind. Leben 5 ff. 

£ "o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



T3 



t! öi 



* 



03 



l/) 



Eine epische Idee im Veda. 245 

Landes (R V 3, 21, 3), diese dagegen (die mikrokosmische) z. B. (cf. 
Vendidad 3 und in der ganzen indischen Profanlitteratur) in der 
Vorstellung der menschlichen Geschlechtsverbindung unter der Form 
der Beackerung des Feldes räumlich und zeitlich ungeheuer weit 
verbreitet vor. 1 Bei verschiedenen indogermanischen Völkern nach- 



1 Dem primitiven Menschen galt das ganze Reich des pflanzlichen, thierischen 
und menschlichen Lebens als eine Einheit, die Promiscuität der einzelnen Gruppen 
als möglich. Die Pflanze ist die Nährmutter des Thieres, dieses die des Menschen, 
oder, um im vedischen Sprachgebrauch zu bleiben: aus dem Wasser kommen die 
Pflanzen, aus diesen das Thier, aus diesem der Mensch. Daher die z. B. in der 
Genesis sich vorfindende Schöpfungsreihe. Anaximander begründet seine Ansicht, 
dass die Menschen von Thieren gezeugt seien, darauf, dass die letzteren früher 
Selbständigkeit erlangten und nach kurzer Säuglingsperiode schon bald eigne Nah- 
rung suchten: Zeitsckr. f. Ethnol. 1, 48. Das warmblütige Thier, resp. den Men- 
schen, als das letzte Glied der gesammten Wesensreihe aufzufassen, nüthigte schon 
die erfahrungsmässige Reduction der Zeugungsfähigkeit bis auf einmalige Geburt, 
von dem Milliarden von Sporen abwerfenden Pilz bis zu dem nur alle vier Jahre 
ein Junges werfenden Elephantenweibchen: Bastian, Elemente n, 27. Paarung von 
Menschen mit (anthropomorph gedachten) Pflanzen sind der Sage nicht im erhört. 
Aus der Betrachtung des Geheimnisses des Wachsthums ergaben sich bald die Ana- 
logieen zur Fruchtbarkeit im allgemeinen und der menschlichen im besonderen. Der 
Mann wurde mit der erzeugenden Pflugschar, die Frau mit der Furche verglichen 
und der oizopoq bezeichnete sowohl den pflanzlichen als den thierischen Samen. 
Daraus folgte das Herumtragen der Phallus-Bilder, des Ititgam und yoni\ Bastian, 
Mensch in der Geschichte 3, 58, cf. ib. 42 und 368, s. a. Hahn, Zeitschr. f. Ethnol. 
26, 607. Der Volksglaube zog seine Consequenzen in der versuchten Befruchtung 
von Weibern durch Bespritzen mit Wasser namentlich «als Erntegebrauch, cf. Pehger, 
Pflanzensagen 192, in der Tüchtigmachung von jungen Ehemännern durch Hinein- 
werfen in einen Brunnen: Mannhardt, Baumkult 1, 488, in der sehr folgerichtig 
durchgeführten Identifizierung des sterbenden und sich erneuernden Lebens mit 
dem im Frühling sich verjüngenden Samenkorn. Das letztere Bild ist nicht blos 
biblisch, sondern findet sich z. B. selbst bei den Indianern: Bastian, Verhleibsorte 
67, es liegt den griechischen Mysterien^zu Grunde: derselbe, Beiträge 82 und muss 
der in Athen gebrauchten Ceremonie den Ursprung gegeben haben, Samenkörner 
auf Gräber zu streuen, ib. 120, Anm. 2. In der Jahreszeit, die den Mutterschoss der 

N 

Erde zum Schwellen bringt, reihte sich durch den Trieb der Liebe Mensch an 
Mensch. Der Frühling zieht in das menschliche Herz nicht weniger ein als in die 
Natur. Die Sitten der Maibrautschaft, der Erwählung eines Maikönigs und einer 
Maikönigin, des Maigrafs und der Maigräfin (cf. Mannhardt, Baumkult 1, 422 ff.) 



geben davon Kunde. Nicht minder bekannt ist der altdeutsche Kornmann neben 
der Kornmutter, der Haferbräutigam neben der Haferbraut (so wird die Binderin 

17* 

o c 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



246 Julius v. Negelein. 

weisbar, klingt letztere Versinnbildlichung auch bei uns bis auf den 
heutigen Tag nach. Zum Schlüsse unserer Betrachtung angelangt, 

der letzten Garbe genannt). In Schlesien wird die Binderin der letzten Garbe als 
Waizenbraut oder Haferbraut, die Erntekrone auf dem Haupte tragend, an der 
Seite eines Bräutigams, von Brautjungfern begleitet, in vollständiger Nachahmung 
eines Hocbzeitszuges feierlich zum Hof eingeholt: Mannhardt, Korndämonen 30. 
Wie man also die Fruchtbarkeit des Feldes unter dem Bilde der weiblichen Zeugungs- 
fähigkeit begriff, so wurde die Halmfrucht ,als ein Kind gedacht, das dem Schoss 
der Erde entsteigt und im Kornschnitt von der Mutter losgelöst wird*: ibid. 28. In 
mehreren Kreisen Westpreussens wird die aus der letzten Garbe verfertigte Menschen- 
gestalt Bankert (uneheliches Kind) genannt und ein Knabe hineingebunden oder 
ein grosser Kerl hinter der Puppe versteckt. Der letzten Binderin, welche die 
Kornmutter darstellt, rufen die Uebrigen zu, sie werde niederkommen; sie schreit 
und weint, wie in Geburtsschmerzen; ein altes Weib als Grossmutter spielt die 
Hebamme. Endlich ruft man, das Kind sei zur Welt gekommen, der eingebundene 
Knabe oder der hinten versteckte Mann wimmert nach Säuglingsart. Die Gross- 
mutter wickelt einen Sack als Windel um den Bankert, und jubelnd führt man das 
Kind, das draussen nicht frieren dürfte, in die Scheune: ibid. 28. Die Wechsel- 
wirkung von menschlicher und pflanzlicher Fruchtbarkeit veranlasste die Sitte der 
Vereinigung menschlicher Paare auf dem jüngst bestellten Acker. Im Rausch wurde 
auf dem Saatfelde der Beischlaf vollzogen, wie sich überall mit den Erntefesten 
Orgien verbinden: Zeitichr. f. EthnoL 21, 144. Diese Sitte ist aus Java bezeugt: 
Bastian, Elemente 112 f., und auch in Indonesien wohl nicht unbekannt gewesen: 
ibid. 75. Die Peruaner betrinken sich zur Saatzeit und verbinden sich mit der 
ersten Frau, die ihnen in den Weg kommt: Zeitichr. f. Etknol. 21, 152. — Der 

in w 

Mythus kennt das Concubinat auf dem Ackerfelde in der Sage von Demeter, die 
auf dreimal gepflügtem Boden den Jasion umarmte und den Plutos gebar. Bereits 
Bastian hat die völlige Analogie der hochbedeutsamen Sage mit der Sita-ldee 
erkannt: Zeitschr.f. EthnoL 17, 218, cf. ibid. Elemente 121. Hier wie dort wird die 
Mutter Erde von einem Menschen schwanger gemacht und gebiert von ihm den 
Getreidesegen. In der Demeter- Sage liegt ,die einfache Allegorie des Erntesegens, 
den der vom Landmann befruchtete Acker giebt*. Büchholz, Homerische Re- 
alien 3, 1, 298 f. ,Spatere Dichter und Mythographen übertragen auf Jasion das 

Verdienst seiner Mutter, indem sie ihm nicht nur die Verbreitung des Demeter- 

o +j 

kults und des Getreidebaus, sondern auch die Erfindung des letzteren zuschreiben,' 

rö — — ° * 

ibid. 299. Wir erkennen deutlich das allmählige Hervortreten des sich Gattenrechte 
anmassenden Sterblichen gegenüber der Göttin Erde, mithin das Grundmotiv der 
Slta-Sage wieder. Auch der letzte Schritt, den die indische Ausgestaltung des alten 



T3 



ö. u 
V öi 



(T3 



2 5 



CD 



Motivs thut, die Verflüchtigung beider Figuren zu mythischen Persönlichkeiten, wie 
Prthu und PrthivI, findet seine Analogie in dem griechischen Paare des Koros und 



1/? 



der Köre, oder dem lateinischen Liber mit der Libera. — Der von Mannhardt in 

dem mehrfach citierten classischen Werke über den Baumkult erwähnte Brauch, 

S "ö 
-ö v 

E-e 

E => 

fD O) 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 









(T3 



$ 5 



F P. 



u 

«4- "ö 



Eine epische Idee im Veda. 247 

kann ich den Hinweis darauf nicht unterlassen, wie schön, wie be- 
deutsam der Gedanke ist, den wir auf dem Wege einer so umständ- 
lichen Beweisführung wiedergewonnen zu haben glauben. Die ge- 
heiligte Institution der Ehe, welche hier bereits in der reinen Form 
der Monogamie erscheint, wird zum Symbol des innigsten Zusammen- 
lebens eines Volksrepräsentanten mit einer im Ackerbau die Keime 
aller höheren Kultur in sich tragenden Muttererde. Die Monarchie 
zeigt in ihrer patriarchalischen Herrschaft, welche das regierte Reich 
als Weib sich unterworfen, die erzeugten Kinder also als Landes- 
kinder sich unterthänig machte, 1 die socialen Verhältnisse einer frühen, 
aber gesunden Zeit, deren Nachklang, im Liede verklärt und fest- 
gehalten, noch manche spätere Generation erfreuen konnte. 

Nur ungern mag ich mich zu einer Auseinandersetzung mit 
der Hypothese Jacobi's (in seinem so verdienstlichen Werke über 



dass in England sich Paare von Männern und Weibern auf der frisch bestellten 
Erde wälzen, ist nichts als eine Abschwächung des im vedischen Ritual fixier- 
ten Beilagers des Räma mit der goldnen Statue der Sita. Auch der 
Glaube, dass der Mensch durch innige Berührung mit der Mutter Erde sich von 
Krankheiten befreie, indem diese ihn gewissermassen zugleich mit der keimenden 
Frühlingssaat von neuem gebärt (ein dem Antäus-Mythus nahe verwandter Zug) 
gehört hierher. Beim ersten Kukkuksruf wälzt sich der Meininger, hessische, west- 
phälische Bauer ein paar Mal auf der Erde, um das Jahr hindurch frei von Rücken- 
schmerzen zu bleiben. Gerade so warf sich im alten Griechenland rücklings nie- 
der und wälzte sich auf der Erde, wer eines Weihen ansichtig ward: Mannhardt, 
Baumkult 1, 483. Bavaria 1863 S. 319 f. Wer an Schwindel leidet, läuft nach 
Sonnenuntergang dreimal nackt um ein Flachsfeld, dann bekommt der Flachs den 
Schwindel: Mannhardt, Baumkult 1, 18. Die Hexen (d. h. die heidnischen Zaube- 
rinnen) baden sich nackt im Roggen, weil sein Tau kräftigt und verjüngt. Der 
Roggentau im Mai vertreibt auch die Sommersprossen: Perger, Deutsche Pßanzen- 
sagen 111 f. 

1 Man vergegenwärtige sich noch, dass der König noch im deutschen Mittel- 
alter als persönlicher Besitzer des Grundes und Bodens galt. Da nun die 
Ackererde belebt gedacht wurde, hatte er an sie die Gattenrechte und Gattenpflichten. 
Wer diese nicht erfüllte, konnte das Schicksal des schwedischen Königs Domaldi 

— O 

508. Muss doch der patriarchalische Monarch vielfach bei seinem Regierungsantritt 



theilen, der wegen Misswuchses getötet wurde: Yngligas. 18 Simrock, Mythologie 6 , ^^ 



gute Ernte garantieren. 

.E -ö 
-ö v 

E-e 

E => 

(ü <D 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



248 Julius v. Negelein. 

das Rümfiyana, Bonn 1893) entschliessen. Möge meine Theorie neben 
der Seinigen zu recht bestehen bleiben. Für uns kommen nament- 
lich die Seiten 127 ff. in Betracht Jacobi widerlegt zunächst die 
Ansichten von Lassen und Weber, nach denen die Eroberung, resp. 
Ausbreitung der arischen Kultur der Inhalt der Räma-Sitä-Legende 
ist und verwirft die Ansicht Talboys Wheeler's, dass in dem Epos 
ein allegorischer Kampf gegen den Buddhismus zu sehen sei. Jacobi's 
Ansicht (S. 130 ff.) geht nun dahin, dass Sita die Ackerfurche, d. h. 
die Fruchtbarkeit, den Erntesegen darstelle, 1 Räma ein Substitut In- 
dra's und Ravana eine Hypostase Vrtra's sei. Es handele sich also 
um den Kampf des Indra (Räma) mit Vftra (Ravana), welcher letz- 
terer dem Indra seine Kühe raubt wie Ravana dem Räma seine 
Sita. Hanumat als Freund Räma's ist der Monsun, weshalb er 
auch Märutfitmaja oder Märuti genannt wird und dem Ravana die 
Sita entreisst wie Saramä, die Götterhündin, den von den Pani's 
versteckt gehaltenen Schatz zurückverlangt, nachdem sie im Auf- 
trage Indra's die Wasser überschritten — ein Bild des die Wolken- 
wasser aus der Hand des Dämons der Dürre befreienden und herauf- 
ti öi 

führenden Sturmes. 

■ 
Zunächst ist nun darauf aufmerksam zu machen, dass Jacobi 

selbst die Identification von Räma mit Vis$u als eine Thatsache be- 
zeichnet, die dem Dichter des ersten und letzten Buches des Epos 
immer vor Augen steht (S. 65). In den fünf echten Büchern aber 
sei, von wenigen eingeschobenen Stellen abgesehen, Räma durchaus 
immer Mensch. Nun frage ich: wie wäre der Process zu erklären 






Q. 



.TD 



(T3 



2 5 



03 



fU 



1 Er fasst die Gründe dafür in folgender Weise zusammen: Schon JJgveda 
4, 57, 6 f. wird die personificierte Ackerfurche unter dem Namen Sita göttlich ver- 
ehrt. In späteren vedischen Texten, die Weber, Abhandlungen der Akad. der Wis- 

03 ^ 

sensck. Berlin 1858, S. 370 — 73 zusammengestellt hat, wird sie ebenfalls als Genie 
des Ackerfeldes, als ein Wesen von grosser Schönheit gepriesen und zwar gilt sie 
dort als Indrapatni und ParjanyapatnI. Namentlich kommt das Adbhutädhyäya des 
Kausika-Sutra und das Päraskara-Grhya-Sutra in Betracht. Dass die Sita des Rä- 

3 o 

mäyana identisch ist mit der vedischen Sita, kann nicht bezweifelt werden, denn 

<J3 

sie kommt aus der Erde hervor, als Janaka einst pflügte (i, 66) und zuletzt ver- 



schwindet sie unter dem Erdboden in den Armen der Göttin Erde (vn, 97). 

.E -o 
-o v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Eine epische Idee im Veda. 249 

und wo hätte er eine Analogie, der einen Gott zunächst zum Men- 
schen umschüfe und diesen dann in einen anderen Gott zurückver- 
wandelte ? Und wo fänden sich Kreuzungen des Indra- und Visnu- 
Kuites die ihrem ersten Urspung nach vielleicht gleich alt sind? 1 
Wo irgendeine Spur der mythischen Person oder Tracht Indra's bei 
Räma? Mir scheint es, als ob schon die Annahme des absoluten 
Verlustes jeglicher die so markante Figur Indra's zierender Attri- 
bute bei Räma's doch jedenfalls historisch schon frühzeitig auftreten- 
der Persönlichkeit sehr gewagt ist. Vor allem aber haben wir ein 
Bedenken: der Stoff der Räma-Sltä- Legende war populär, die Sage 
von der Heldenthat Indra's ein seit ältester Zeit als fortbildungs- 
unfähig sich erweisendes brahmanisch-doctrinäres Machwerk. Neben 
der uns erhaltenen Priesterpoesie des Veda hat es eine volkstüm- 
liche Kunst und Kunstpflege gleichen 2 oder höheren Alters gegeben. 

1 Ich glaube, es ist ganz verfehlt, den Sectenzerfall, von dem sich doch 
schon im Veda ganz handgreifliche Spuren finden, für die erreichbare älteste Zeit 
der indischen Litteratur in Abrede zu stellen. Namentlich muss Varuna seine 
speciellen Verehrer, die ihn monotheistisch ausstaiteten, gehabt haben, während er 
dem grossen Volke nur Wassergott war. Darauf weisen mit grosser Bestimmtheit 
die Wünsche der Sänger hin, zu Varuna's Heimstätte zu gelangen, wie anderer- 
seits von dem Glück auf Visnus höchster Stufe gesprochen wird. Alles diess wäre 
doch unsinnig, wenn wir ein geeinigtes Pantheon annehmen. Vielmehr verlangt 
ein jeder Sänger die von dem Gott seiner Verehrung als Remuneration für dieselbe 
gespendete specielle Seligkeit. Auf eine frühere Stufe führt der Himmel des Yama 
zurück, der mit den meist solaren Gottheiten des Veda, die den eschatologischen 
Ideen noch ganz entrückt waren, nichts zu thun hat. Ein sicheres Indicium für 
die Existenz eines speciellen rgvedischen Visnu-Kultes scheint mir namentlich in 
der unendlich häufigen Wiederholung des Preises seiner drei Schritte zu liegen. 
Entweder hält man die vedischen Sänger für Paralytiker, die nur denselben Satz 
zu schwatzen vermochten, oder man vermutet in dieser Einseitigkeit eine Tendenz 
und ich sehe nicht, welche Tendenz man in ihr vermuten könnte als die, jene 
traditionelle Riesenthat als ein Wunder von Visnu's Macht in die Welt hinauszu- 
posaunen, um sich dadurch anderen Seiten gegenüber zu behaupten; wie die Ver- 
fasser unserer alten christlichen Kirchenlieder beständig das Liebesopfer Christi in 
apologetischer Absicht preisen. 

2 ßgveda 9, 10, 3 spricht z. B. von Königen, die durch Preisgesänge ver- 
herrlicht werden. Diese Verherrlichung muss im Rahmen der volksthümlichen 
Poesie und durch Barden erfolgt sein. Ueber die Pflege des Rämäyana im Rahmen 

"fö ■ 4 - J 

einer Bardendichtung spricht sich Jacobi S. 62 folgendermassen aus: Wie wir aus 

.E -ö 
-ö v 

E-e 

E => 

fD O) 



CÜ 






T3 



O o 



(T3 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



TD 






CD 



■o 



cn 



250 Julius v. Negelein. 

Beide gingen nebeneinander her, es ist aber höchst unwahrscheinlich, 
dass sie ineinander übergingen, vielmehr hatte jede Gattung der 
landläufigen Poesie ihr vorgeschriebenes Schema, das sie einhielt 
und in dem sie sich wohl fühlte. Man vergleiche die Recepte zur 
Anfertigung des zehntägigen Gesangscyclus beim Rossopfer, wie 
das Qatapathabrähmana sie giebt; man vergleiche unsere Theorie 
der Entstehung der Räma-Sitä-Legende. Was berechtigt uns zu der 
Annahme, jene uralten Bardenschulen hätten sich des von den Brah- 
manen so lange breit getretenen Stoffes bemächtigt? — Noch andere 
Gründe sprechen gegen Jacobi's Hypothese. Ueber V^tra sind zwar, 
wie wir wissen, die Acten nicht geschlossen. Meine alsbald näher zu 
begründende Ansicht habe ich an anderem Orte geäussert. 1 Jeden- 
falls deckt sich die Hauptfunction Vitras, die Himmelswasser gefangen 
zu halten, unter Zugrundelegung der bisher angestellten natursymbo- 
lischen Deutungsversuche in keiner Weise mit der Thätigkeit des 
raubenden und entführenden Ravana. Wichtig wäre folgende Unter- 
suchung: der Monsum geht bekanntlich in südwestlicher Richtung; 
Indra erschlägt den Vj'tra nach den Angaben der Brähmana in ganz 



dem Rämäyana selbst erfahren, wurde es von Rhapsoden theils recitativ vorgetragen 
(jpath), theils unter Begleitung eines Saiteninstruments gesungen (i, 4, 8; 34. vn, 
71, 14 f.; 94, 4 u. s. w.), und mündlich überliefert (i, 4, 10 flf.) zunächst von den 

o ^ 

beiden mythischen Söhnen Räma's und Zöglingen Välmiki's, Kuca und Lava, in 
deren Namen man schon lange die volksetymologische Ausdeutung von Kucilava 
(Barde, Schauspieler) gesucht hat. In alten Zeiten, als die epische Poesie blühte, 
bestand ebenfalls die Institution der fremden Sänger, Spielleute, 
Rhapsoden, und es ist natürlich, dass jedes Gedicht, welchen Ursprungs es auch 

(L) ^ 

gewesen sei, nach Art der epischen Gesänge fortgepflanzt, d. h. durch Rhapsoden 
mündlich überliefert wurde. Das war auch mit dem Rämäyana der Fall: es wurde 
zum Eigenthum der fahrenden Sänger. — Dass Jacobi die volksthümliche Poesie 
für sehr alt hält, drückt er auch S. 63, Anm. 1 aus: ,erst nachdem der Rhapsoden- 
stand gesunken war infolge des Aufkommens einer kunstvolleren Dichtung und 
deren Pflege in anderen gelehrten Kreisen, und nachdem die Schrift immer mehr 
praktische Verwendung gefunden hatte, wird man zur schriftlichen Aufzeichnung 



des bis dahin mündlich Ueberlieferten übergegangen sein/ ibid. 62, Anm. 1 : ,Dass 



die vortragenden [Rhapsoden] ursprünglich Brahmanen sein mussten, scheint 



mir durch vi, 128, 115 nicht bewiesen.' 

1 Zeitschr.f. Ethnol. Jahrg. 1901, S. 77. 

^ tn 

£ -o 
-ö v 

E-e 

E =3 

fD O) 

tn x: 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



Original fronn 



Eine epische Idee im Veda. 251 

bestimmten Himmelsrichtungen. Wenn diese letzteren nicht aus- 
schliesslich oder vornehmlich mit der Richtung des Monsums überein- 
stimmen, so ergiebt sich angesichts der Starrheit und Zuverlässigkeit 
der brahmanischen Tradition daraus von neuem ein schwerwiegen- 
des Moment gegen Jacobi's Theorie. — Wenn ich den Parallelismus 
von Vrtra und Ravana als haltlos bezeichnete, so wird diese Auf- 
fassung dadurch, dass der Sohn des letzteren Indrajit ; also Indra- 
töter heisst, kaum widerlegt. Für den dem Gotte unterlegenen 
Vrtra wäre dieser Name der denkbar ungeeigneteste gewesen und 
kommt auch thatsächlich niemals vor. Ausserdem sind die Namen 
der Söhne mythischer Persönlichkeiten, also des Indrajit gegenüber 
dem Ravana, meist der Ausdruck jüngerer Manifestationen ihrer 
Väter, lassen also auf halbverschollene Reste der Wesenheiten oder 
Thaten dieser wohl kaum jemals schliessen. — Auch in der Hand- 
lung des Rämäyana kann ich keine Aehnlichkeit mit dem Inhalt 
der Indra- Vj'tra -Legende entdecken. Kann man denn den Raub 
einer Frau als spätere Entwicklung aus dem Raube einer Kuh auf- 
fassen? Jacobi freilich wendet die Frage anders, indem er nicht 
die Handlungen der Sage, sondern deren ihnen nach seiner Meinung 
zukommende natursymbolische Bedeutung in Analogie zu einander 
stellt und Sita wie die Kühe des Indra als Ackerbau- und Wasser- 
genien aufFasst. Ein solches Verfahren ist doch aber nur gerecht- 
fertigt, wenn die Sltä-Legende in einer Zeit entstanden wäre, in der 
die natursymbolische Bedeutung der Indra -Vrtra -Sage noch am 

° E 

Tage lag, also in einer (auch nach Oldenberg's dankenswerthem 
Hinweis) der Abfassung des Rgveda vorausliegenden Periode. 
Wenn wir aber ferner den avestischen Veretragna als Beweis für 
das gewaltige Alter des Indra- Vrtra-Mythus in seiner vollen, körper- 
lichen Sagengestaltung hinzunehmen, so stösst die Hypothese einer 
Entlehnung der Sage in der ihrer mythischen Verdichtung voraus- 
liegenden Zeit auf unüberwindliche Widersprüche. Diess meine Be- 






w I 

fN CO 

f\l ^ 

, O) 

o y 



> <u 

denken gegen Jacobi's Erklärungsversuch. 

Dem im Vorausgehenden, schon vor mehreren Jahren Aufge- 
stellten habe ich der Hauptsache nach nichts hinzuzusetzen. Noch 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



252 Julius v. Negelein. 

immer sehe ich in den von Kuhn so glänzend nachgewiesenen indo- 
germanischen Sagenzügen von der Vermählung von Nymphen mit 
Sterblichen den Urkeim unserer Legende; in der Auffassung von 
weiblichen, den allgemeinen Nymphencharakter wahrenden Local- 
gottheiten als den segenschwangeren Weibern ackerbautreibender 
Männer die erste Ausgestaltung des Räma-Sitä-Mythus ; in der Ent- 
führung der Sita durch den Raksas Ravana in kulturhistorischer 
Hinsicht eine alte Form des räksasa-viväha oder der Raubehe, wie sie 
gerade in der ersten Zeit der arischen Ansiedlungen in den von Ur- 
einwohnern bevölkerten Gegenden des nordöstlichen Indiens häufig 
-i 

genug gewesen sein mag, in mythologischer Hinsicht aber mit 
einer wenngleich nicht völligen Sicherheit eine Wiederkehr des alten 
Persephone-Motivs. Wir wiesen bereits im Vorausgegangenen auf die 
Wahrscheinlichkeit hin, dass der Idee der Liebe des Ackerfeldes 
zu einem Sterblichen der Mythus von der Begattung der frucht- 
tragenden Erde durch den männlichen Himmel vorausgegangen oder 
parallel gelaufen sein mag. Auf germanischem Boden steht die Liebe 
der eingeschlafenen Pflanzengöttin zu dem sie küssenden Götterjüng- 
ling, der strahlenden Sonne, im Mittelpunkt dieser Sagen. 1 An Stelle 
des Schlafes tritt im indischen Mythus das plötzliche Verschwinden 
und Wiedererscheinen aus dem Ackerboden, die Verbannung der 
Sita, übrigens ein dem Germanenthum ebenfalls geläufiges Motiv, 2 
resp. ihr Geraubtwerden durch einen Dämon. 3 Die Vermenschlichung 
dieser mythischen Gestalten hat nichts befremdendes. Wir wiesen 
bereits darauf hin, dass ein sehr consequent durchdachter Parallelis- 
mus zwischen menschlichem und pflanzlichem Wachsthum, zwischen 
animalischer und vegetabilischer Zeugung im Völkerglauben existiert. 
Wie man der Fruchtbarkeit des Ackerbodens dadurch förderlich 



w i 

fN CO 

f\l ^ 

, O) 

o y 

O o 

c v> 

o E 



03 



2 5 



03 

F P. 



u 

«4- ~° 



03 



03 



03 



1 S. Mannhardt, Baumkult 1, 422 — 447, der die Versionen dieses Mythus 
bearbeitet. 

2 Cf. ib. 444 f.: Die Entrückung der Vegetation wird immer unter dem Bilde 



> <u 

3 O 

der verlassenen Geliebten, Gattin oder Braut und dem Verweilen des Mannes in 



entlegener Ferne ausgedrückt. 



3 Ib. 445. 



.E -ö 
-ö v 

E-e 

E => 

03 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



(T3 



F P. 



u 



CD 



TD 



Eine epische Idee im Veda. 253 

sein zu können hofft, dass. man sich auf ihm begattet — in der ab- 
gemilderten Form sich einzelne Personen oder Paare sich auf ihm 
herumwälzen 1 — wie er stets als der weiblichfruchtbare und mütter- 
liche erscheint und deshalb zu den Frauen in besondere Beziehung 
gesetzt wird, 2 so gilt die ausgetragene Frucht des Herbstes als der 
nach Geburt ringende Keim des im künftigen Jahre sich erneuern- 
den Lebens. Deshalb wird z. B. in der germanischen Auffassung 
neben der Meinung, dass die Geister des alten Jahres im neuen ihre 
Wirksamkeit wieder beginnen, der Glaube festgehalten, dass die 
Vegetationsdämonen des Ackerfeldes durch Schnitterhände ihren Tod 
fanden, um zu immer neuen Zeugungen wieder zu erstehen. Des- 
halb ruft man der die Kornkuh darstellenden Binderin der letzten 
Garben zu, sie bulle, d. h. sie bereite sich zur neuen Empfängniss 



1 Mannhabdt, Baumkult 1, 480 ff. weist darauf hin, dass die Liebesspiele zur 
Frübjahrszeit die Zeugungskraft der sich verjüngenden Natur versinnbildlichen (?) 
sollten und berührt die Sitte des gemeinschaftlichen Sich -Wälzens auf dem Acker- 
boden, das nicht nur auf der Insel Moone (a. a. O. 469), sondern auch in England, 
der Ukraine, Kelbra (goldene Aue, Kreis Sangerhausen), Scharrel (Saterland), und 
Hessen vorkam. Noch erwähnen wir folgende Bräuche: Nach Ethnologische Mit- 
theilungen aus Ungarn v, 20 muss man sich bei den Hienzen, wenn es donnert, 
auf die Erde werfen; dann wird es ein gutes Jahr geben. Die Bulgaren sagen: 

LT) ^f- 

Wer sich im Frühling beim ersten Donnern nicht auf der Erde wälzt, bekommt 
das Fieber: Straüsz, Bulgaren 385. In Mecklenburg heisst es: Wenn man zum ersten 
Male den Wiedehopf hört, soll man sich auf der Erde rollen, dann bekommt man 
keine Kreuzschmerzen: Bartsch, Mecklenburgische Volkssagen 262. 

2 Mannhabdt a. a. O. 1, 217 sagt: Es ist klar, wie infolge des schon mehr- 
fach von uns bemerkten Glaubens an Sympathie zwischen menschlichem 
Wachsthum und pflanzlichem Wachsthum verheiratete Frauen, gleichsam 



das Fruchtfeld darstellend, dazu kommen konnten, von dem Maibaum und 
Vardträd als den Repräsentanten der Zeugungskraft Kindersegen, resp. leichte Ent- 



bindung zu erwarten; — und ibid. 1, 216 f. setzt er auseinander: ,der im Acker 
grünende Lebensbaum stirbt mit der Ernte ab, aber aufs neue soll er gepflanzt 
werden in der Erde Schoss, und daraus Früchte treiben. Darum gehört er den 
Frauen zu eigen, darum dürfen nur diese ihn aus dem Boden reissen und nach 



Hause fahren, resp. im Frühling aus dem Walde in das Dorf holen. Diese ihre 
Thätigkeit schien den Alten eine Gewähr, dass die in das Feld gestreute neue Saat 
auch die hervorbringende Muttererde, den grossen Lebensschoss, günstig finden 
werde. Hier sind also die Frauen rein sinnbildliche Vertreterinnen einer allge- 
meinen Idee. 1 

.E TD 

TD v 

E-e 

E =3 

ft3 <D 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



Original fronn 



254 Julius v. Negelein. Eine epische Idee im Veda. 

vor. 1 Der deutsche Mythus von der immer wieder erstehenden 
Kornfrau, ,the old woman who never dies', findet sich auch bei den 
Dacotah 2 und sonst. 8 Auf den Molukken muss beim Blühen der 
Nelken und auf dem Ackerboden Stille beobachtet werden, wie bei 
Schwangeren, da durch Erschrecken Abort erfolgen könnte. 4 Es 
wäre zwecklos, die Beispiele zu häufen; genug, dass das Princip 
des sehr weit gehenden Parallelismus zwischen Mensch und Pflanze, 
Weib und Ackerfeld, als erwiesen gelten darf, und dass wir die 
Idee der versuchten geschlechtlichen Befruchtung des Feldes durch 
Menschen als einen zunächst rein wörtlich zu verstehenden Brauch, 
in zweiter Linie als Allegorie der lebenerzeugenden Beackerung des 
Bodens durch Menschenhand kennen gelernt haben. Wie in ältester 
Zeit, makrokosmischen Vorstellungen entsprechend, die Erde parjan- 
yapatni, d. h. Gemahlin des Parjanya heisst, 6 so wird der König als 
bhuvo bhartä, Gemahl der Erde, 6 gefeiert. Die erstgenannte Auf- 
fassung hat auch auf germanischem Boden genaue Parallelen. 7 

Nur noch einer Einzelheit sei gedacht: Jacobi, Rämäyana, S. 133, 
Anm. 1, erwähnt, dass der Name des Räma im Veda, ,schwarz', 

c o 

später ,lieblich' bedeutet und mithin keinen Anhalt zur mythologi- 
schen Erklärung der Persönlichkeiten gebe, die Räma heissen. Nun 
wird Räma Mahäbhärata 12, 953, cf. 7, 2243 als yuvä 9yämo lohitä- 
kso, als dunkelfarbiger Jüngling mit rothen Augen, bezeichnet. Als 
Etymologie seines Namens ist, da räma im klassischen Sanskrit nicht 
mehr schwarz heisst, diess 9yämo wohl nicht aufzufassen. Woher 
kommt die merkwürdige Darstellung von Räma's Habitus? 



w i 

fN CO 

O u 



O o 

c v> 
o E 



1 Mannhardt, Korndämonen, 10. 

2 Bastian, Elemente ii, Vorw. 32. 

F P. 



u 

«4- ~° 



8 Journal of the Anthropologicai Institute of Great Britain and Ireland> vol. 31, 
p. 157 ff. 

4 Bastian, a. a. O., S. 32. 

5 Atharvaveda, 10, 10, 6, cf. 12, 1, 42. 

6 Raghuvansa, 1, 74. 

Mogk, Grundriss für germanische Philologie*, 3, 359 sagt: Thrudr ist die Kraft 
schlechthin: als Tochter der Sif ist sie vielleicht die treibende Kraft des Erdbodens» 
die der Donnergott durch seine Umarmung mit der neu erwachten Erde ins Leben 
gerufen hat. 
-ö v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 









Koptische Ostraka. 

Von 

J. Krall. 



Unter diesem Titel 1 hat W. E. Crüm eine ausgewählte Samm- 
lung koptisch beschriebener Topfscherben und Kalksteinsplitter aus 
verschiedenen Sammlungen, vor allem des British Museum und des 
Museums von Cairo, im ganzen über fünfhundert Nummern heraus- 
gegeben. Er hat diesen kleinen Texten grosse Sorgfalt zu Theil 
werden lassen; wie die zahlreichen Nachträge zu seinen ursprüng- 
lichen Lesungen zeigen, war er unermüdlich bemüht die richtige 
Lesung festzustellen. Durch seine Uebersetzungen und Erklärungen 
hat er das Verständniss dieser Texte sehr gefördert. Reiche Indices 
und einzelne Schriftproben beschliessen das Werk. 

Die gewonnene Ausbeute ist eine reiche. Nicht blos auf dem 
sprachlichen Gebiete, wo wir eine reiche Nachlese zum koptischen 
Wörterbuch erhalten, sondern auch auf dem culturhistorischen, wo 



■o 



03 



(T3 



wir einen authentischen Einblick in die Zustände und Verhältnisse der 
thebanischen Landmark am Ausgange der byzantinischen Herrschaft 
und während der zwei ersten Jahrhunderte der arabischen gewinnen. 
Denn fast alle koptischen Ostraka stammen aus Theben, und von 
diesen weist uns eine grosse Anzahl auf das Kloster (totco<;) des Apa 



> <u 

c 



o 



1 Coptic Ostraca, from the Collections of the Egypt Exploration Fund, the 



Cairo Museum and others, with a Contribution by the Rev. F. E. Brightman. Spe- 
cial Extra Publication of the Egypt Exploration Fund, 1902 (im Nachfolgenden als 
CO citiert). 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



256 J. Krall. 

Phoibammon von xhmc hin, welches Crum im Gegensatze zu Stern 
in der Ruinenstätte des Tempels von Deir el Bahari erkennen möchte. 
Wir lernen eine Reihe von Persönlichkeiten kennen, die in diesem 
Kloster lebten oder zu demselben Beziehungen hatten, so einen 
Bischof Abraham, der nach Crums Vermuthung mit jenem Bischof 
von Hermonthis identisch ist, der auf dem heiligen Berge der Mem- 
nonien residierte. Neben ihm erscheint der Priester Victor, wohl der 
Hegumenos dieses Klosters, den zahlreiche Ostraka kennen. Auch 
der Bischof Pesynthios von Koptos, der vor der persischen Invasion 
auf den Berg von ähmc flüchtete, wird allem Anscheine nach er- 
wähnt. Mehrere dieser Topfscherben rühren von denselben Schreibern 
her, wieder andere weisen uns auf Schreiber hin, die uns aus den 
Papyrus von ähj** bereits bekannt sind. Innere Zusammenhänge 
sind zwischen vielen dieser Topfscherben unverkennbar. Sie werden 
sich mehren, je vollständiger das Material vorliegen wird. 

So glaubte auch ich zur Ergänzung des reichen von Crum zu- 
sammengebrachten Materials einige Nachträge liefern zu sollen, die 
hauptsächlich auf eine Reihe von Topfscherben und Kalksteinsplittern 
zurückgehen, welche ich auf meinen ägyptischen Reisen 1884/5 und 
1898 zu erwerben in der Lage war und die inzwischen der hiesigen 
ägyptischen Sammlung sowie der Sammlung der Papyrus Erzherzog 
Rainer 1 in der k. k. Hofbibliothek einverleibt worden sind. 

Der Thon, auf dem diese koptischen Texte geschrieben sind, 
ist gröber und weniger fest und haltbar als jener der griechischen und 
demotischen. Darum findet man äusserst selten vollständige Stücke. 
Der Thon ist braun und meist gerippt. Eine Ausnahme bilden die 
amtlichen Entagionquittungen, bei welchen die Qualität des Thons und 
demgemäss die Erhaltung eine bessere ist. Neben den Thonscherben 
findet man zahlreiche beschriebene Splitter des schönen Kalksteins 
aus Biban el Moluk. In der Werthschätzung steht der Kalkstein- 
splitter (Plax) in der Mitte zwischen dem Papyrus (Chartes) und der 



t! öi 



Cl 



03 
ö> 



F ö. 



u 

«4- ~° 

O <L> 

*s 

'l/l ö 1 

s_ 

<u 
> <u 

c 

=) 

c (5 

CO 



Topfscherbe (Ostrakon). Wiederholt lesen wir auf diesen Kalkstein- 



1 Im Folgenden als PER citiert. 



.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Koptische Ostraka. 257 

splittern die Entschuldigung, dass der Briefschreiber keinen Papyrus 
zur Verfügung hatte, da er auf dem Lande weilte. Paläographisch 
weisen diese Kalksteinsplitter eine grosse Einheitlichkeit auf und 
dürften wohl mit wenigen Ausnahmen der ersten Hälfte des siebenten 
Jahrhunderts zuzuweisen sein. 

Der Inhalt dieser koptischen Ostraka ist im Allgemeinen ein 
reichhaltigerer als jener der griechischen, welche auf das Gebiet der 
Finanz Verwaltung beschränkt sind. Crum gibt uns zuerst biblische 
und liturgische, dann Texte, die sich auf kirchliche Angelegenheiten 
beziehen; ferner Rechtsurkunden, Listen und Inventare und zum 
Schlüsse Briefe mannigfachen Inhalts. 

Unter den Wiener Stücken sei zuerst ein Ostrakon der ägyp- 
tischen Sammlung herausgehoben, welches sich, wenn nicht alles trügt, 
in merkwürdiger Weise mit einem CO, No. 252 mitgetheilten verbindet. 

Aegyptische Sammlung, Nr. 6014 (1885 erworben): 

f JUläwp 

■^ 

J\iK feTTA^p'iOC 
£ o 

Itaat&/)£6>pHTKC 

I- <h 

ItUJIHT OTT2S.&J 

i\*poTr.M/i*, wofür ein anderes Ostrakon (CO, No. 459) itn<\pooMK\ 
(ncoAoMüm) schreibt, ist das griechische üapoiptia und demgemäss das 
Ostrakon zu übertragen: ,Die Sprüche des Apa Euagrios, des Ana- 
choreten von Sketis. Heil!' 

Wenn wir nun in einem Ostrakon des Museums in Cairo (CO. 
No. 252) neben anderen Bücherforderungen auch die Mahnung lesen 
den Apa Euagrios zu senden (<vpi T&^*nH acoov &n& gtt&^pioc), so 
drängt sich uns die Vermuthung auf, dass es eben das Wiener 
Ostrakon war, welches die gewünschte Zusendung begleitete. Noch 
ein anderer ähnlicher Fall liegt vor. In dem Ostrakon CO, No. 240 
wird die Zusendung der ,Kerygmata des Apa Damianos l verlangt, 
in dem Ostrakon CO, No. 18 heisst es ähnlich wie in dem Wiener: 
,Die Kerygmata des Apa Damianos, des Erzbischofs von Ale- 
xandria/ 



T3 



> ^ 

£ ö. 

P 

U 

O <L> 

*s 

5 „ 
— o 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



258 J. Krall 

Wir haben es hier mit dem Kirchenschriftsteller Euagrios Pon- 
tikos, dem Lehrer des Palladius und Rufinus aus der zweiten Hälfte 
des vierten Jahrhunderts zu thun, dessen Leben, Werke und kirchen- 
geschichtliche Stellung in letzter Zeit 0. Zöckler eingehend behandelt 
hat (Biblische und kirchenhistorische Studien, iv). Euagrios kam 
nach Aegypten um in den nitrischen Bergen, der Wüste Sketis und 
der Einöde Kellia ein hartes Asketenleben zu führen. Unter seinen 
sicher überlieferten Schriften findet sich keine, die man zweifellos 
mit den in unserem Ostrakon genannten Paroimia identificieren 
könnte, wenn wir nicht annehmen wollen, dass die Bezeichnung Ila- 
poijjua ungenau und allgemein ist. In diesem Falle könnten wir ent- 
weder an den Mova^o^, welcher kurz von Gennadios als ,Euagrii 
sententiae' citiert wird, oder den rvco<raxö<;, ,Das Buch der 50 Sen- 
tenzen', denken. Doch sei darauf hingewiesen, dass noch zahl- 
reiche unedierte Schriften des Euagrios in syrischen und arabischen 
Uebersetzungen vorliegen. Unter diesen finden wir eine ,Ad imita- 
tionem Ecclesiastae Cantici Canticorum et Proverbiorum Salomonis' 
angeführt, welche freilich Zöckler (a. a. O. S. 42) dem Kirchenschrift- 
steller Nilus zuweisen möchte, und von einem Euagrios heisst es bei 
Suidas s. v., dass er ein mö^r^a elq toc^ llapoqju'as SoXojaövtos ge- 
schrieben habe. 

in ^ 

Der bereits erwähnte Victor, Hegumenos des Klosters des Apa 
Phoibammon, bediente sich mit Vorliebe des Schreibers David; wenn 
wir auf der nachfolgenden Plax einen Oikonomos des Topos des 
Apa Phoibammon und als Schreiber einen David genannt finden, so 
müssen wir annehmen, dass der Hegumenos Victor auch die Stellung 
eines Oikonomos bekleidete, was auch sonst zu belegen ist. 

Aegyptische Sammlung, No. 6015 (1885 erworben): 



CÜ 



Q. O) 



2 5 
F p. 



u 

«4- ~° 

O <L> 



f &HOK UJCUOTTTe CTC£<M 
IvßlHTtOp HOIROtlOMOe JA. 



£JA. nOTCOUJ JAimOTPTe ^O IKJCT 

5 jaoc erpe^ oTiiHuje n§o\oH/ 



ifl tn 

£ -o 
-0 v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Koptische Ostraka. 259 

jsiöw MneiCii^ft &KOR U|ettOTTT[€ 

10 cäujcj* ttKoi&9_R tiTpo[jvuie 
nert2^eRÄ.THC m 

f Ich Schenute schreibe Biktor dem Oikonomos des Klosters 
(tötcoc) des Apa Phoibammon. Nach dem Willen Gottes bin ich be- 
reit Dir zur entsprechenden Zeit (*atpo<;) ein halbes Goldstück für 
die Aufwendung (avaXwjjLa) für den Acker zu geben. 

Ich Schenute bin mit diesem Texte einverstanden (<7ToiyjsTv). 

Ich Dauid habe diese Plax am 17. Choiak der elften Indiktion 
geschrieben. 

Diese Plax zeigt die schöne, sichere Hand des Schreibers David. 
Crüm nennt sie die Hand D. Untersuchungen nach dieser Richtung 
lassen sich, so lange nur der kleinste Theil der Ostraka und Pa- 
pyrus in photolithographischen Reproductionen vorliegt, nicht weiter 
verfolgen. Sie dürften aber bei dem Umstände, dass ein grosser 
Theil dieser Urkunden von Berufsschreibern, deren Zahl in einer 
kleinen Ortschaft wie Gerne nicht sehr gross sein konnte, geschrieben 
ist, mit der Zeit sich sehr fruchtbringend gestalten. Dann werden 
sich zusammenhängende Reihen dieser Topfscherben herstellen lassen 
und wird man dem schwierigen Problem der Entwicklung der kop- 
tischen Paläographie und der Datierung der Urkunden nach paläo- 
graphischen Kriterien näher rücken können. Noch immer bleibt der 
Markstein für die Datierung der Texte das Turiner Ostrakon mit 
der Erwähnung einer Sonnenfinsterniss, welche ich auf den 10. März 
601 fixieren konnte (Aeg. Zeitschr. 1883, S. 80). 

Die Thätigkeit der Berufsschreiber, die wir noch heute in den 
Strassen ägyptischer Städte antreffen, beleuchtet ein Beispiel, das 
der Correspondenz des Anwalts Apa Schenute aus dem siebenten Jahr- 
hunderte entnommen ist, welche ich in einer Gruppe von Papyrus 



T3 






w i 

fN CO 

O u 



o o 

c v> 
o 2 



(T3 



> 

F P. 



> <u 

aus der Schmüner Gegend gefunden habe und in nicht zu ferner 



Zukunft herausgeben zu können hoffe. Unter den Correspondenzen 



ro 



finden wir auch zahlreiche Briefe eines gewissen Philotheos, Sohn 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 18 

o c 

E => 

in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 









260 J. Krall. 

des Phoibammon aus der Ortschaft Parigori, welche alle von einer 
sichern und geübten Hand geschrieben sind. Daneben finden wir 
eine Rechtsurkunde, welche von Philotheos ausgeht, und da finden 
wir am Schlüsse derselben sein Semeion, da er des Schreibens un- 
kundig war und Christophoros für ihn unterschreiben musste. Die 
Briefe waren eben von einem Berufsschreiber, wahrscheinlich von 
dem Schreiber von Parigori geschrieben. 

Auch in unseren Topfscherben wird der Berg und das Kastron 
ahm am häufigsten genannt. So lesen wir in dem unvollständigen 
Ostrakon aus Deir-el-Medinet 

PER, Kopt. 8040 (Sammlung Wiedemann 1 ): 
f *noR JtuoirCHC 

jvie ctic^&Y it^ecop^eoc nujnpe 
niw^nrtHC iipM.2£.HM.e %/*. itno 

Moyses und Psate, welche auf dem Berge von ä.hmc wohnen, 
schreiben dem Georgios, dem Sohne des Johannes aus ähac in dem 
Nomos von Ermant. 

Die Zeichen und Zeilen, welche auf das m der fünften Zeile 
folgten, sind absichtlich von dem Schreiber verwischt. Der Text 
war wohl gegenstandslos geworden und der Schreiber gedachte sich 
des Kopfes der Urkunde gelegentlich bedienen zu können. 

Des Apa Phoibammon, nach dem das Kloster von Gerne be- 
nannt war, wird öfter in unseren Texten gedacht. So auf der Plax 



* 



PER, Kopt. 8004 (Kr. 4): 
= i 

F p. 



ItMÄ.pTTpOC 

o <L> 

Der ^.^pTTTpoe Apa Sklabinos ist sonst nicht bezeugt. 

Das Fest des aoi* q>oi&fc[Möm (vgl. CO, No. 455) wird auf dem 



<u 



=> o 



Verso einer Plax aus Erment erwähnt 

CO 

1 1893 der Papyrus-Sammlung Erzherzog Rainer geschenkt. 

.E ~o 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _q 

ü Q_ 



Original fronn 



0} 






(T3 

jc 



u 

O <L> 



Koptische Ostraka. 261 

PER, Kopt. 8063 (Sammlung Wiedemann): 

Ausser Gerne und Ermont finden wir in dem hiesigen Materiale 
noch die Ortschaft (;x<üpioii) Timamen, die bereits aus dem Pa- 
pyrus No. 14 von Gerne bekannt war (Revillout, Actes 94, vgl. auch 
Stern, Kopt. Gr., S. 435, Amelineau, Geographie 506), auf dem Frag- 
mente einer flachen Schüssel aus röthlichem Thone genannt. Dieses 
Ostrakon ist seinem Materiale nach eines der besten Stücke der 
Sammlung und gehört zu jener feinen Töpferware, welche nach 
arabischen Autoren (vgl. CO, S. xi) wenigstens in späterer Zeit Luxor 
eigenthümlich war. 

PER, Kopt. 8006 (Kr. 6): 

f ev ovofxaTi t 6eou i t uiou i t ayc tcvsu a|*Y)V t^p<x<fl[i xaße 

8 ■€► 

Va ... iv f t ^ftOK n^TcpMOTT nujitpe mttm^r epejM 

- e t 

&c §m n^copicoh ttTiM.&MHtt irnoMOC mnoA epj^on. 



eie^dii ti'fotK<o& uujHpe ärmr/ nerpoc qm. im^CTp/ 
h»l€M€ iiiiomoc nTinoA hottcöt ^«wipem ate 5/n hj^ä 

AVUTpiMHCIOrt ItT* ^CpCttpiOC npJSUl§iOM/ I\€CA.M. 



? 

Q. 



03 



= Tpe OTTCOUjß JUMOq 
OTT IipHMllR^CTpOli ItHTfcrt OTT2k.fc *qei €T<ÜOT 

Die Entagion (evTotyov) Quittungen, auch äusserlich an ihrem 
lichten Thone und der guten Erhaltung kenntlich, werden von Crum 
auf Grund der Identität einzelner Schreiber mit solchen, die aus da- 
tierten Papyrus aus Gerne ihm bekannt waren, in die Mitte des 
achten Jahrhunderts gesetzt, der Schrift nach hätte man sie für 
älter halten können. Sie sind ziemlich gleichmässig nach folgendem 
Schema verfasst. 

PER, Kopt. 8015 (Kr. 15): 



t £IC OT 

§o\or/ UÄ. 



pifej*.i& &q€i 



=> O 

— o 

c O 

<J3 

fcTOOT IlTOOTK 

ru ■£ 

5 11TOR HÄ.IdiC// 

18* 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



262 J. Krall. 

II £1 TUpCOTK R&T&. 

ßoirAK irrcipoMne 
TCT&.pTK yt/ ap a fx aOup 

§0 ? 

10 xS iv/ S KÄ2fi.OTrat n&. 

IC P *H\ /////// 

imiiiiiiiiiiiuii 

/////////////////// 

f Siehe ein Goldstück ist mir zugekommen durch Dich Elias 
. . la als Deine Zahlung (Sta^pa^ov) für die erste Rate dieses vierten 
Jahrs. 

Das macht ein Goldstück. — 26. Athyr, 4. Indiktion. 

Kagu£ der Vorsteher stimmt zu (aioiy^Tv). 

Psate, Sohn des Pisrael 

Von dem Schreiber Psate, Sohn des Pisrael liegen uns zahl- 
reiche Entagiontexte vor. Der Name R&ÄOTrac. entspricht dem grie- 
chischen Ka66xYj<;, vgl. Spiegelberg, ,Eigennainen' 16*. 

Andere Beispiele liegen vor 

Ostrakon, PER Kopt. 8003 (Kr. 3): 

f eic otrqoKoi\/ ii ^p 
^m.\ö. ^qei eTooT 51 

TOOTR ItTOR CGTHpOC 



t! öi 



^ u 

y 

O o 

c w 

o E 



§ S 



£i TinpoTK k&t&^oAh n 



TfcpOAUic ohtohc yt/va 

9«p[i a iv / ö 
? 



nicirit-e-i fiiRTtop 



1° Yai^nnec n^A. 



3^poc «MCMrt 

Severos Elias hat die erste Rate für das achte Indiktionsjahr 
am 1. Pharmuti desselben Jahrs erlegt. Der Vorsteher Pesynthios (?) 



No. 421) hat es geschrieben. 



u 

«4- ~° 

o <u 
*S 

■h! ■— 

'i/l öl 
s_ 

<U , 

> <U 

C CT 

=) O 

— o 

Biktor stimmt zu (arot/eiv). Ioannes, Sohn des Lazaros (vgl. CO, 

"3 ti 

_£; fT3 

.E -ö 
-0 £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Koptische Ostraka. 263 

Ostrakon PER, Kopt. 8033 (Kr. 33): 

f *IC OTT 

JÄ.I&. Äqfci eTOOT ojto 

OTR t\TOK &.ftpdt&.M. IlA^Ä. 
?? 
5 tt&CIOC OjX H£KÄ.IA.^pöw<$>Otl OJ 

T — 

tiuho R«wT^ßoAH ivreipojuit 

8° 
gkthc yt ap/ a p. aGup x£ iv/ S 

f ^€02k.6>poe nMlH ^"CTOI^^ 

Theodoros der Vorsteher bestätigt von Abraham 7 Sohn des 
Athanasios (?) die erste Rate für das sechste (Indiktions-)Jahr am 
27. Athyr desselben Jahrs erhalten zu haben. 

Das Entagion CO, No. 410 nennt auch einen -^eos^copoc luuie. 

Noch zwei, leider sehr schlecht erhaltene Entagion liegen uns 
vor, auf der Rückseite des einen lesen wir den Namen (des 
Schreibers?) <i*hK äiktcop, den wir auch CO, No. 196 wiederfinden. 

Wir haben uns den Vorgang folgendermassen vorzustellen. Die 
Gemeinden (roiiuothc) 1 erhalten von der Staatsgewalt den Auftrag 
zur Zahlung der Gemeindesteuern (§Y)[/,6(jta vgl. CO 422), der in diesen 
Texten otofypacpov für das correcte Siorfpa^ (vgl. Wilcken, Griechische 
Ostraka i, 9lA, 648) genannt wird. In dem Entagion des Leidener 
Museums (Catalogue du Musee d'Antiquites ä Leide, Antiquites coptes 
von Pleyte und Boeser, p. 24 fl.) geht der Auftrag von den äicoot«, 
,den Herren' aus, unter welchen in der arabischen Zeit die Staats- 
gewalt verstanden wurde (Springer, Aeg. Zeitschr. 23, 141). Dieses 
Entagion lautet, so weit ich den Text herzustellen im Stande bin, 
folgendermassen : 

,f Ich Mena, der Sohn des Stephanos für Joseph, schreibe an 
Senuthios: Siehe Du hast mir zwei Trimesion gegeben, gemäss dem 
Befehle unserer Herren, denn sie haben es auf Dich geworfen (nout 

1 In meinen koptischen Rechtsurkunden (Corp, Main, n) S. 126 kommt eine 
KOincüTHC des Epoikion Apa Phoibammon vor. CO, No. 407, 408 finden wir eine 
KOmcoTHC Mivrooir (des Berges), in dem PER, Kopt 4914 die roiiuothc des 
Epoikion Taai&j*.KT n^iÄ.e&., welche durch den Vorsteher (n&.ne) und den Ge- 
hilfen (nfcoH-eoc) vertreten ist. 



CÜ 



t! öi 



Q. 



03 






F P. 



W LT) 

.£ -o 
-o v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



264 J. Krall. 

nach dem griechischen ßaXXecv) für dieses Jahres der 14. 

Indiktion. Zu Deiner Sicherung habe ich Dir das Entagion ge- 
schrieben und stimme ihm bei. Geschrieben am 3. Payni der 4. In- 
diktion . . . .' 

Die Gemeindevorsteher (auhttc) haben die Steuerquoten von 
den einzelnen Gemeindemitgliedern einzutreiben, sie stellen die Em- 
pfangsbestätigungen aus und liefern dann die Summen an die Staats- 
kassen ab. 

Wie die Abkürzung t*r/ in dem nachfolgenden Ostrakon auf- 
zulösen sei, ob als i^iopd — denn an t&h[oiiuathc] lässt sich kaum 
denken — oder anders, bleibe dahingestellt. 

PER, Kopt. 8008 (Kr. 8): 

eTllTOT€ MMlllt€ 

5 Ttic£&¥ n& Ott epoc 

JMIOOTT 2C€ €tl€llÄLe 

— 

iiTOTe cqn*^ otojoAok/ 

? ? ? 

0) 

JUl&pidt 

10 IlK*T«wITCH IG&^tUtHC 
H&JIK JÄ.H. T&R/ THpC 
TtlCTOI^C 

o_<0Te e 

15 \qIIIH 

Ioannes der Vorsteher und die ganze .... sichern der Mari 
den Antheil, den sie bisher gehabt hatte, bis zu ihrem Tode zu. 
Ein Vorsteher, der ihr den Antheil nehmen wollte, hätte ein Gold- 
stück der Maria (?) zu zahlen. 

M&pi steht für M&pi&, bzw. jAApig&M.. 

Zahlreich sind die Ostraka, welche mit der Formel €ic iiAo^oc 



TD 






O o 



(T3 



2 5 



F P. 



O <L> 
'i/i öi 



=> O 

— o 

MnnoirTe beginnend sich als Entscheidung unter göttlicher, d. h. kirch 

'S ■ 



licher Autorität geben 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

to _c 

s_ C 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Koptische Ostraka. 265 

PER, Kopt. 8030 (Kr. 30) : 

t 
ec tvKo 

voc tUlftOTTTfe 
H.TOOTR HTOR 

5 ty^it ä.€ imeR 
sstnOTT KeA^Tre 
ciepej&i&c ntR 
ujupe eirvn pame 

00 

encoR Oj\poq eis^tt 

r-- 

R&iiq o_A.poq 

T A>KOR n* 

o 
o 

TpOC 

Z. 11. Das erste q ist aus r verbessert. 

Siehe das Wort (Xo-^o«;) Gottes wird Dir Psan, dass Du Nichts 
anderes für (?) Jeremias, Deinen Sohn forderst, noch einer Deiner 
Leute , auch nicht wegen des Demosion, das wir für ihn über- 
nehmen (?). Unterschrieben von Petros. 

PER, Kopt. 8032 (Kr. 32): 

f &KOK AtepROirpiOC Att ^€OfX.6> 

pOC ItA^UHlITT MIlR&CTpOtl natHAic 

tN W 

üte eic nAo^oc jÄ.ntioiTTG i\to 
otr itRti feootrit eneKHi d^trco 

O o 





(T3 



$ 5 



O <L> 






Aus diesem Ostrakon, dessen unterste Zeilen arg verwischt 
sind, lernen wir zwei Laschanen des Kastron Gerne kennen, Mer- 
kurios und Theodoros. Die Formeln erinnern an die CO, No. 108 
bis 111 mitgetheilten. 

Die Pluralform A<vujrit finden wir auch CO, No. 80, Ad 60. 

Wir finden die Formel *ic nfto^oc ^nnoTic auch in einem Pa- 
pyrus des Museums in Alexandrien, den ich 1899 abgeschrieben habe. 



t MHti& necnpitt nj*.Än<y&M.OTÄ. 



äitco hä^ior/ nq 5 ate n\oroc ja. 

fD -^ _ _ 

COjXI tV&€6m& UltOTPTe IlTOOTR 

.E -ö 
-ö v 

E-e 

E => 

fD O) 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



266 J. Krall. 






o o 



> $ 
F P. 



fD 





IU?£Ü»TCp Clt 


ttpcoMC en&p&. 




g^mottA. itnöw 


v€ mmok ace 




eitoT nemc 


nu&M^i^TVe 


10 


rohoc npoM 20 ^lO/irno^p &.<$>€ 




ne Ä-iii ecoT 


eni\o^oc f e^p 




acovTtyic tt 


Mtcop/ i^ in ä. f 




5 / 
Mecopn üw. 111/ 


f MHIt&C 




uj&. cott ac.OTr\|ric 


CVIl 


15 


itMCCop/ e iit / 


HIHI 



Ü£€ IURA. Aä^TT 

Menas, der Archivar (scriniarius) und Verwalter (StotxYjTYfe), über- 
trägt dem Kameelhirten Theona nach dem Worte (ko^os) Gottes die 
Wartung der Kameele seines Vaters des Bischofs auf ein Jahr, von 
dem 29. Mesore der 4. Indiktion bis zum 29. Mesore der 5. Indiktion. 
Es dürfe kein Mensch ihn täuschen (Ttapdyw) und auch er keine 
Umschweife machen (ajjLftßaXXetv). Menas unterschreibt (uTuoYpofystv). 
Geschrieben am 19. Mesore der 4. Indiktion. 

In unseren koptischen Texten finden wir wiederholt Personen, 
welche die Würde eines Dioiketes bekleideten, ihnen wurde, wie CO, 

c o 

No. Ad 17 zeigt, der Titel iMoTrcTpioc gegeben (mAAoTPCTp/ -eeo^topoc 
nen^og iu^i €tou»ho_ ojt \Jnrit*itTCoit£ tmtiOMoe itRÄTj. 

Für den Ausdruck härtok, welches dem lateinischen pactum ent- 
spricht (CO, No. 169) finden sich zahlreiche Belege in dem oben (S. 259) 
erwähnten Chartular des Anwalts Apa Schenute. So in dem Papyrus 

PER, Kopt. 4901: 

f «MlÖIt tl€RAHpOltOMOC tnMd.KA.piOC t$»Olß&MM<Ott OJTOOTIt 
dUtOK AMMüiUt Mit 5^^Api^C ItC^M ttllltCOtt n2kIÄR°/ ATTA. 
♦€02k.6>pe 3C€ &tt2£I «kTTCO «wttllAHpOTr ftTOOTR lUIÄRTblt 

enciriiTfcA.Gi mocj k<vii Oj\ neivreTApToit Mtpoc oit ne 

5 rthm&. tuiM&tietpcettdk Mti neivreT&pTOit Mepoc ojt Mit 

iteujt\q npoc tö'om tneReM^HTtTTMÄ. ctc rai ite taiott 
ttA^ojt ttHpn Mit iiR&pnoc eßKite ciriiTe tintyi niOM 

> <u 

C CT 

=> o 



]TipOMne T&.I n€ltTeR^IT€RÄ.THC 1112k. j £T&£ TICR 
(OpiXL OTTIl diltCMIt TCIÄTtOÄ^GIglC lt&>R ltCTOI^€I CpOC f 
10 f AltOR dtMMCOItC ItCTUJHpilCOjkl TICTOI^CI CTIÄTlOÄ^Clfg 



Ä.TTÖ) Ti*nocci>&e har 5A. s&^Äkpia.c Ojk neqMepoc f 

.E -ö 
-ö v 

E-e 

E => 

fD 0) 



Original fronn 



1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

C _Q 

ü Q_ 



Koptische Ostraka. 267 

f Wir die Erben (xXY)pov£|j(.oc) des seligen Phoibammon durch 
uns Ammone und Zacharias, wir schreiben unserem Bruder dem 
Diakon Apa Theodore. 

Wir haben erhalten — und sind von Dir befriedigt (wXrjpoöv) — 
das Festgesetzte (pactum), welches Du uns entrichtest (cuvtsXsTv) für 
unser Viertel vom Besitze in Manarsena und unser Viertel an . . . und 
den Schweinen (?), gemäss Deinem Pachtvertrage (£{jt.©6T£u|j.a), das sind 
nämlich 50 Lahe Wein und die Frucht von zwei Palmbäumen nach 
dem Maasse von Piom, in diesem Jahre der fünfzehnten Indiktion. 

Zu Deiner Sicherstellung nun habe ich diese Quittung Dir aus- 
gestellt und wir stimmen (gtoix^v) ihr zu. 

f Ich Ammone, der oben verzeichnete, stimme (axotxsTv) dieser 
Quittung (aiuoSst^t«;) zu, und ich (nehme es auf mich, jeden der) Dir 
für Zacharias in Bezug auf seinen Theil (entgegentreten sollte), zu 
verscheuchen (aTuocoßelv) f. 

ötouocoßsTv ist ein technischer Ausdruck, der aus byzantinischen 
Urkunden uns bekannt ist (vgl. Wessely, Prolegomena 29 axoaTirjsiv 
x.ai a^oatoßtv). Ammone und Zacharias haben das tcoxtov erhalten. 
Zacharias ist bei der Ausfertigung der Quittung nicht anwesend um 
sein (rzoiy^h hinzuzufügen, so übernimmt es Ammone jeden, der 
wegen des an Zacharias bezahlten Theiles des üocxtcv dem Apa 
Theodoros Schwierigkeiten machen wollte, zu verscheuchen (aTuoaoßelv). 

Die Ortschaft j**it&pcen* ist uns bereits aus dem Papyrus Erz- 
herzog Rainer, Kopt. 1324 (Kopt. Rechtsurk., S. 90) bekannt. Nicht 
blos diese Ortschaft ist beiden Papyrus gemeinsam, der Papyrus 
Kopt. 1324 nennt auch die Erben des seligen Phoibammon, wie der 
eben publicierte; es ist kein Zweifel, diese Papyrus gehören zusammen 
und weisen auf eine gemeinsame Fundstätte, auf das Chartular des 
Apa Schenute hin, obwohl der eine Papyrus erst etwa ein Decen- 
nium später als der andere nach Wien gekommen ist. 

Ueber das Maass Aa^h, von dem wir in diesem Texte ein 
neues gutes Beispiel erhalten, habe ich Kopt. Rechtsurk., S. 183 ge- 
ilt. 

Das Morste Maass (vgl. CO, No. 165, 21 7) finden wir im Ostrakon: 



ti öi 



Cl 



03 



F p. 



u 

«4- ~° 

O <L> 

*S 

■h! ■— 
'i/i öi 
s_ 
<U 
> <U 

c 



o 

handelt. 

"3 ti 

ifl tn 

£ -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



268 J. Krall. Koptische Ostraka. 

PER, Kopt. 8029 (Kr. 29): 

neuom 

Mit OTPAIÄX« It 

iicoto * eigame 
5 nK€i(OT iiktt eÄo\ 

TÄ*C MMWTCH 



^ith. necirr* 

ttCOT R&A.CDC 

fN 

Wie das letzte Zeichen der zweiten Zeile zu lesen sei, bleibt 

6 

zweifelhaft. CO, No. Ad 16 finden wir ein §w tieiovr, und ebenso 

r--> 

No. 309, No. 170 ein 550 nopg. Daneben ist das Maass §ot bekannt. 
Bei dem Worte Amtum (Hgnum), welches auf der Plax CO, No. 
Ad 30 in der Verbindung ujj*ovn hAir/ h^ojaiit und neben der Gruppe 
2tcvTÄqTe nu|€ n§oMHT erscheint und von Crum mit ,basket' übersetzt 
wird, möchte ich darauf hinweisen, dass uje sowohl ,hundert', als auch 
,Holz' (lignum) bedeuten kann. Ist vielleicht uje n^oMtvr einfach die 

|_ in 

Uebersetzung von Xm/ njcu/uvr? 

Verse der Ilias (zu CO, No. 523, 524) fanden sich auch auf 
einem von mir 1885 in Elephantine erworbenen Ostrakon (vgl. 
Wessely, Wiener Studien vm, S. 116 fl.). 

Vergleicht man die Gesammtheit der Texte des siebenten bis 
neunten Jahrhunderts aus Gerne mit den gleichzeitig geschriebenen 
aus dem Faijüm oder aus Schmün, so zeigt sich, dass das arabische 
Element in den thebanischen fast gar nicht vertreten ist, obwohl ein 
grosser Theil derselben unter arabischer Herrschaft geschrieben 
wurde. Wir finden fast gar keine arabischen Namen und gar keine 
Lehnwörter. Gestützt auf die Klöster bildete die koptische Bevöl- 
kerung in diesen Theilen Oberägyptens eine geschlossene Einheit. 
Eine gewisse Kenntniss der griechischen Sprache ist dagegen in den 
gebildeten Kreisen nicht zu verkennen. 

Wien, 29. Juni 1902. 



o E 



> ^ 
£ ö. 

P 

U 

«4- ~° 

o " 
> 

4-J 

l_ 

<u , 

> <u 

C CT 

=) o 

— o 

c O 

.E -0 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o 5 



F P- 



Die Erzählung vom blauen Schakal in den Ham- 
burger Pancatantra-Handschriften. 

Voa 

Johannes Hertel. 

wrrfft : üntenm wirr i *ro *n«if««*i«u««iq.*0<«i: *W ^rnn: i 



1 Das %J<\ ist auffällig. Eosko. liest BWfl, ebenso die anderen Ausgaben. 
Die Lesart der Hamb. Hss. kann daraus entstanden sein. 



o <u 

*s 

'i/i öi 

> <U 

C CT 

3 O 

— O 

c O 

.E -ö 
-ö v 

E-e 

E =3 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






■o 

Q- 



.TU 



(T3 



2 5 
F P. 



270 Johannes Hertel. 

u^ hup* wg: i ^r ^r fttqii*iiriiM{41 ^rrr i ^rrera K«imi««iHi 
^f^r: usrfwr i ffaRt tKvraw* i 3 s^rrraforr: ^rrwr: flücim 

^Wt TOfirfTT ^TTrTT W^RT^T^ fWTI ifff : I *ft TTfffTT ^T- 

^rnyir: wcfr «pro i *nft^ w*ftf* i «»i«h«rttt 3%fa 2 1 ^n ^ i 



Von dieser Erzählung, die ich hier nach den Hamburger Hss. 
gegeben habe (unter stillschweigender Korrektur der orthographischen 
Fehler, einschliesslich einiger weniger Verstösse gegen die Sandhi- 
Gesetze) liegen Varianten vor in Jätaka 3 172 ? 188, 241. 

Freilich bieten alle diese Fassungen nicht dieselbe Erzählung, 
die der obenstehende Text enthält, sondern sie zeigen nur verwandte 
Züge. Im 172. Jätaka wird erzählt, wie einst nach einem Regen- 



1 WHl! Möglicherweise nicht nur Schreibfehler. Man beachte, dass 
>m Jaina- 
3f* II 



wir es 



u 

«4- ~° 

o <u 

mit einem Jaina-Text zu thun haben. Daher auch der Indicativ statt des Imperativs. 

> 0) 
C CT 

8 Leider ist mir nur die Uebersetzung des Jätaka zugänglich, so dass ich 
nicht sagen kann, ob in dem noch nicht übersetzten Teil desselben etwa eine 
weitere Variante vorhanden ist. 

LT) LT) 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Die Erzählung vom blauen Schakal etc. 271 

gusse die Löwen vor der Höhle ihres Führers brüllen. Da erhebt 
auch ein Schakal seine Stimme, und beschämt schweigen alle Löwen. 
Darauf folgt ein Gespräch in zwei Strophen zwischen dem Führer 
der Löwen und seinem Jungen. 

Jät. 188 ist eine weitere Ausführung des Vorhergehenden. Ein 
Löwe hat zwei Junge, das eine von einer Löwin, das andere von 
einem Schakal -Weibchen. Das letztere gleicht in allen Aeusserlich- 
keiten seinem Vater. Einst nach einem Regengusse brüllen die Löwen ; 
das will auch das Junge des Schakalweibchens thun — aber seine 
Stimme gleicht der seiner Mutter, und sofort verstummen alle Löwen. 

Das Junge der Löwin fragt nun seinen Vater in einer Strophe 
nach dem Wesen seines Bruders, und sein Vater klärt es auf. Dar- 
auf ermahnt dieser das Junge des Schakalweibchens, zu schweigen, 
damit die anderen Löwen seine Natur nicht erfahren, und fügt die 

Strophe hinzu: 

,A11 will see what kind you be 

If you yelp as once before; 

So don't try it, but keep quiet: 
ö. jy 

Yours is not a lion's roar.' ,_ __ __ _ . 

(W. H. D. Rouse.) 

Jät. 241 ist viel ausfuhrlicher und nähert sich der Pancatantra- 
Erzählung viel mehr; andererseits ist der Bericht auch wieder viel 
weiter ausgesponnen, als diese. Einst war der Bodhisatta der Kaplan 
Brahmadattas von Benares. Er kannte einen Zauberspruch, mit dem 
man sich die Welt unterwerfen konnte. Als er diesen einst repe- 
tierte, hörte denselben ein Schakal und prägte sich ihn ein. Der 
Schakal rief dem Bodhisatta zu, er könne nun seinen Zauberspruch, 
und entzog sich dann der Verfolgung durch die Flucht. Im Walde 
machte er sich durch den Spruch alle Tiere unterthan. Er ward 
ihr König und setzte sich auf einen Löwen, der auf dem Rücken 
zweier Elefanten stand. Da will er in seinem Uebermute die Stadt 



CÜ 



W I 

fN CO 

f\l ^ 

O u 



O o 

c v> 
o E 



F P. 



ct 



Benares nehmen. Mit einem mächtigen Heer von Vierfüsslern rückt 



> V 

er davor und fordert den König zur Uebergabe oder zum Kampf 



auf. Der Bodhisatta steigt auf einen Turm und fragt den Schakal, 
wie er die Stadt nehmen wolle. ,Ich will die Löwen brüllen lassen', 

.E -ö 
-ö v 

E-e 

E => 

ro O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



272 Johannes Hertel. 

antwortet dieser, ,und mit dem Gebrüll der Menge Schrecken ein- 
jagen/ Da lässt der Bodhisatta alle Bewohner der Stadt ihre Ohren 
mit Mehl(-Teig?) verstopfen; dasselbe geschieht mit den Haustieren. 
Sodann fragt er den Schakal nochmals, wie er das Reich zu nehmen 
gedenke. Als er dieselbe Antwort erhält, spricht er seinen Zweifel 
daran aus, ob die Löwen ihm gehorchen werden. Der aufgeblasene 
Schakal erwidert: ,Nicht nur werden mir die anderen Löwen ge- 
horchen, sondern ich will sogar (!) diesen einen, auf dessen Rücken 
ich sitze, allein brüllen lassen/ Das geschieht; da werden die Ele- 
fanten scheu, der Schakal fällt herab und wird von ihnen zertreten. 
Es entsteht ein mächtiges Getümmel, und alle Tiere, ausser den 
Löwen, kommen um. Die Letzteren flüchten in die Wälder. 

Hier haben wir also ganz entschieden eine andere, offenbar 
aber zum Teil weniger ursprüngliche Redaktion unserer Pancatantra- 
Erzählung. Der Schakal macht sich zum Herrn der Tiere und 
kommt durch allzugrossen Hochmut um. Der Zug, dass die Tiere 
des Waldes sich bei des Schakals Stimme schämen und ihn absicht- 
lich umbringen, fehlt. 

Eine andere Redaktion der Erzählung von dem übermütigen 
Schakal, dem es im Umgange mit Löwen übel ergeht, findet sich 
Jät. 335 und Panc. (Bühler) iv, 4. Alle diese Fabeln gehen wohl 
auf ein Original zurück, und dass sie sehr alt sind, beweist der Um- 
stand, dass schon bei Somadeva, also doch wohl auch bei Gunäcjhya, 
ein Sprichwort auf sie anspielt (Kathäs. 6, 59): 



t! öi 



w I 

fN CO 

r\l ^ 

, 0> 

^ u 

o u 



O o 

c v> 
o E 



F p. 



u 



tra i, S. 224) und in der äukas. t. orn. 15. Hier ist sie offenbar dem 
Pancatantra entlehnt, ebenso wie 6uk. orn. 9. 10. 12. 14. 41. 48. 59. 68. 



Bei Somadeva, in den Ausflüssen der PahlavI-Uebersetzung, 
sowie im südlichen Pancatantra fehlt die Erzählung. Ksemendra 
hat sie, wie verschiedene andere, sicherlich aus den Prosafassungen 
seiner Zeit aufgenommen (i, 56 ff.). Sonst kommt sie noch im Hito- 
padesa vor 1 (mit verändertem Eingang; vgl. Benfey, Pantschatan- 

> 0) 
C CT 

=> o 

— o 

CO 

1 Pet. S. 104 f. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Die Erzählung vom blauen Schakal etc. 273 

Es ist nicht meine Absicht, hier alle die abweichenden Züge 
der einzelnen, im Ganzen identischen Sanskritfassungen zusammen- 
zustellen, die ja alle leicht zugänglich sind. Jedenfalls bieten die 
Hamburger Hss. die älteste Form des Textes. Sie haben den Zug, 
dass der Schakal in eine Indigokufe fällt, mit allen Quellen gemein- 
sam gegen Suk., wo er in eine ganze Reihe derselben stürzt. Dass 
dies sekundär ist, liegt auf der Hand. Der falsche Name, den sich 
der Schakal selbst beilegt — dieser Zug fehlt im t. orn., der Suk. 
und dem Hitopadesa — lautet bei Kosegarten •R^J?*^, in den an- 
deren Ausgaben ^<g£*i«. Vgl. dazu Benfey, Pantsch, n, Anm. 291. 
Dies scheint mir ein Deutungsversuch des <2<3%*** der Hamburger 
Hss. zu sein. Offenbar haben wir es hier mit einem Worte zu thun, 
das, wenn es überhaupt einen Sinn hat, nicht sanskritischen, sondern 
^dialektischen' Ursprungs ist. Die Erzählung tritt ja erst bei dem 
Jaina-Redaktor des textus simplicior auf. In der 6uk. lautet der 
wirkliche Name des Schakals ^P^T». Das deutet ebenso auf eine 
Umformung von ^pjJifT, das der Verfasser des textus ornatior der 
Sukasaptati nicht verstand und vielleicht für einen Schreibfehler an- 
sah. Der unverständliche Name war wohl auch für Pürnabhadra, den 
Verfasser des t. orn. des Pancatantra, die Ursache zur Auslassung 
der Angabe, dass sich der Schakal einen falschen Namen beilegt, 
und zur Aenderung der Ueberschriftsstrophe. Er ändert nämlich 
Päda d zu : ^sNpSST^ft *I*1T. Denn dass er den textus simplicior 
benutzt hat, habe ich B. K. S. G.W., phil.-hist. Kl. 1902 nachgewiesen. 

Führt uns also alles darauf, in dem Namen *§*§?**♦ das Ur- 
sprüngliche zu sehen, so weisen noch zwei andere Anzeichen auf 
die grössere Altertümlichkeit unseres Textes. Das erste ist das drei- 
deutige Wort ^f^RiT Z. 26. Im Hitop. und in der Sukasaptati 
werden überhaupt die Aemter, die der Schakal den Tieren über- 
trägt, nicht specialisiert. Der t. orn. des Pancatantra liest genau, wie 
die Hamburger Hss. Alle gedruckten Ausgaben des t. simpl. geben 






w i 

fN CO 

° m 



o E 



(T3 



2 5 



dafür mwWTt>WSTT:. Zweifellos ist dies die sekundäre Lesart. 

Das zweite Anzeichen für die grössere Ursprünglichkeit un- 
seres Textes ist ein ganz vortrefflicher Zug, der hier erhalten ist, 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



274 Johannes Hertbl. Die Erzählung etc. 

Im Panc. orn. gehen die Hunde auseinander, als der Schakal in die 
Kufe gefallen ist. Wer diesen Zug erfunden hat, muss die Natur 
des Hundes sehr schlecht gekannt haben. Kosegarten liest im 
Siinpl.: H*: *iR*T\itaT^ ^TWrf^RnTPRft * W T* ftgffoj ^TW I 
Kielhorn, K. P. Parab und Jivänanda Vidyäsägara lesen : fHTRT (!) 
tn^Jiqurf ^mH«IM^n ^TRft° ***j: I Die Hunde haben den 
Schakal in das Indigofass fallen sehen, und nun, da er heraussteigt, 
erkennen sie ihn nicht wieder ! Diese Motivierung ist wahrlich 
schlecht. Ganz vorzüglich dagegen ist die Fassung der Hamburger 
Handschriften. Die Hunde haben sich in den Schakal verbissen 
(H^HTRSn !) und fallen mit ihm zusammen in die Kufe; und als sie 
herauskommen, sehen sie alle blau aus. Da nun die Gestalt des 
Schakals der der Hunde gleicht, so finden sie ihn natürlich nicht 
unter ihrer Schar heraus, und er entkommt. 

Die Ausgaben, die samt und sonders auf überarbeiteten Hand- 
schriften beruhen, geben eben sprachlich und inhaltlich ein schiefes 
Bild vom textus simplicior. Kosegarten, dem die wertvollen Ham- 
burger Hss. zu Gebote standen, hat sie leider nicht zu würdigen 
vermocht. Sein Text ist geradezu wertlos. 

Zwickau (Sachsen), den 4. März 1902. 

u 

n 

3 

[Soeben erhalte ich aus der Bibliothek des India Office die beiden Hss. F 
und G, von denen die erste in ihrem Anfang den t. siinpl. , die zweite eine beson- 



t! öi 



, 0> 

dere Rezension, die des Ananta, enthält. Beide erzählen den Vorgang wie die 

o 

c v> 
o E 



2 I 



F p. 



u 



Hamburger Hss. Der Name des Schakals lautet in F erst ^R^^T*, dann ^S«R^1Tt. 
In ü sind von den drei ersten Aksara des Namens in der Ueberschriftsstrophe nur 
die oberen Querbalken geschrieben ("""""""TT»)- Offenbar fand der Schreiber (oder 
Autor ?) auch in seinem Texte *^§SfV> hielt aber die undeutbare Form für einen 
Fehler. Im Verlauf der Erzählung fehlt dann der Name. Statt ^f*l«IIT liest F 
fTT^PSrrrfcP^lTT*, während in G etwas Entsprechendes fehlt. Da G die anderen 
Aemter aufführt, so deutet diese Auslassung wohl auch auf einen dem Autor un- 
verständlichen Ausdruck, wie es ^ITT'PST höchst wahrscheinlich war. 

Döbeln, den 31. Juni 1902. J. H.l 

> <u 

C CT 
=> O 

— o 

c O . 

I s 

£ -o 
-ö v 

E-e 

E => 

ro <V 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 






w i 

fN CO 

f\l ^ 

° m 



o o 

c v> 
o 5 



(T3 



fD 



Anzeigen. 



J. Barth. Diwan des 'Umeir ihn Schujeim al-Qutämi herausgegeben 

und erläutert von . Mit Unterstützung der k. Akademie der 

Wiss. in Wien. Leiden (Brill) 1902. (V, xxiv, 53 S. in 4°). 

c 0mair b. Sujaim, genannt alQutämi ,der Falke', 1 war ein an- 
gesehner Dichter der früheren Marwänidenzeit, wenn er auch nicht 
in der ersten Reihe stand. Er war ein echter Beduine vom Stamm 
Taghlib, und seine Gedichte zeigen noch einiges von dem stolzen 
Sinn, der die mehr als ein Jahrhundert ältere Mo'allaqa des Tagh- 
libiten-Führers 'Amr b. Kulthüm erfüllt. Für uns haben diese Gedichte 
besonders dadurch Wichtigkeit, dass sie die gewaltigen inneren Kämpfe 
der Araber jener Zeit beleuchten. Als Marwän auftrat, dem Ibn 
Zubair die Herrschaft streitig zu machen, geschah es fast zufällig, 
dass sich die in Syrien befindlichen Araber von Qais-Stämmen auf 
die Seite des Mekkanischen Chalifen schlugen und daher mit den 
Kelb, die sich sofort dem Marwän angeschlossen hatten, zusammen- 
stiessen. Die Schlacht bei Marg Rähit entschied zu Gunsten der Kelb 
und Marwän's, aber die Qais hatten immer noch eine beträchtliche 
Macht, und namentlich ihr angesehenster Führer Zufar b. Härith vom 

° N 

Stamme Kiläb war noch ein keineswegs zu verachtender Gegner. 
Wie die Qais seit nicht langer Zeit die Kelb in ihren Gebieten in 



03 "? 

> <u 

C CT 

=) o 



1 



1 *A!a3 wird dem JL^> gleichgestellt. Es ist wohl speciell der , Würgfalke' 



Falco lanarius s. sacer Brehm, Vögel 3, 220 — 224. 



Wiener Zeitschr. f. d. Kunde d. Morgeul. XVI. Bd. 19 

E => 

fO <D 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



276 J. Barth. 

der syrischen Wüste einzuengen suchten, so machten sie es mit den 
Taghlib in der mesopotamischen. Da verstand es sich fast von selbst, 
dass die Taghlib und, bei der damaligen Neigung zum Zusammen- 
schliessen grosser Gruppen, auch die übrigen Rabi'a, namentlich die 
Bekr, auf die Seite Marwän's und seines Sohnes traten. Die grim- 
mige Feindschaft der Taghlib und Qais wie der Kelb und Qais zuckte 
auch noch lebhaft weiter und erzeugte blutige Thaten, als 'Abdal- 
melik nach dem Fall Ibn Zubair's alleiniger Herrscher geworden 
war; diese Dinge machten dem verständigen Fürsten viel Noth. 1 
Unser Dichter spricht mehrfach von solchen Kämpfen, die theils für 
die Qais, theils für seinen Stamm siegreich ausgefallen waren. Er 
selbst hatte tapfer mitgefochten. In einem dieser Zusammenstösse 
war er in Gefangenschaft gerathen; schon wollte man ihn umbringen: 
da rettete ihn Zufar und beschenkte ihn sogar mit 100 Kameelen. 
Allem Anschein nach that er das nicht aus reinem Edelmuth, son- 
dern der ehrgeizige Häuptling wusste, was es bedeutete, sich einen 
namhaften Dichter aus feindlichem Stamme zu verpflichten und von 
ihm fortan gefeiert zu werden. Das geschah denn auch. Qutämi 
besingt den Zufar in mehreren Liedern als ein Muster aller edlen 
Eigenschaften und als seinen stets zum Geben bereiten Gönner. Der 
gelegentlich eingeflochtene Hohn über seinen Stammgenossen Achtal 
mag wenigstens zum Theil darin begründet sein, dass dieser weit 
berühmtere Dichter auch nach dem Friedensschluss dem Zufar feind- 
lich gesinnt blieb. Uebrigens feiert Qutämi auch einen anderen Qai- 
siten, den in Küfa lebenden Asmä b. Chäriga aus der hochangesehnen 
Familie der Banü Bedr von den Fazära (m und xvn). Uneigennützig 
war natürlich ein solches Dichterlob nicht. 

Qutämi, an sich kriegerisch gesinnt — zeigen ja die präch- 
tigen Verse xvra wilde Kampflust — spricht doch eindringlich für 
den Frieden unter den Araberstämmen. Dass er namentlich die 
Kelb eng mit den Rabi'a zu verbinden sucht, ist nicht auffallend; 



CÜ 






■o 



O o 



F P. 



'i/i öi 

wohl aber, dass er ganz Nizär, d. h. also auch die Mu(Jar (Qais und 



3 ^ 
— O 
c O 

CO 

1 S. Hamäsa 260—264. 658 f. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Diwan des 'Umeir ibn Schujeim al-QutämI. 277 

Chindif) in dies Bündniss einzuschliessen sucht, xxix stellt den Qo- 
4ä c a ; deren bei Weitem bedeutendster Stamm eben die Kelb waren, 
vor, dass sie nicht, wie man anzunehmen pflege, zu den Jemeniern 
gehörten, sondern dass sie die nächsten Stammesbrüder der Nizär 
seien. Ein solches Streben war jedenfalls im Sinne 'Abdalmelik's. 
Diesen Chalifen feiert er in mehreren Gedichten, namentlich auch in 
dem eben schon erwähnten xxix. Anderen Gliedern des Herrscher- 
hauses gelten andre Gedichte von ihm. Dass die QoraiS der wahre 
Herrscherstamm seien, spricht er mit Nachdruck aus. 

Wie Lob so steht dem Dichter auch beissender Tadel zu Ge- 
bote. Dieser trifft angesehne Leute wie den neben Zufar an der 
Spitze der Qais stehenden Sulaimiten 'Omair b. Ilubäb, und ganze 
Stämme wie die Muhärib, von denen eine alte Frau ihn ungastlich 
behandelt hatte (xv). 1 

Die Taghlib waren damals wahrscheinlich noch zum grössten 
Theil Christen. Im Unterschied von Achtal war aber Qutämi Mus- 
lim. Er zeigt auch gelegentlich, dass er etwas vom Koran weiss 
(z. B. xxix, 40 ff.), und an einer Stelle verhöhnt er Stammgenossen als 
Unbeschnittene (xxi, 16 ff.). Aber tief geht sein islamisches Bewusst- 
sein nicht. Er fühlt sich deutlich mehr als Taghlabl denn als Muslim. 
Merkwürdig ist xxvi, 4, wo er einem vorwirft, dass er, obgleich er 
einst den hohen Namen ,Knecht Jesu' 2 geführt habe, sich doch als 
untreu beweise. 

O 

In seiner Art zu dichten zeigt sich auch Qutämi wesentlich als 
Epigone. Der Kreis der Gegenstände, welche ein Dichter behandeln 

'(75 ro 

durfte, war ziemlich eng umschrieben, und auch im Einzelnen hielt 

2 | 

- "r? 

F p. 



■o 






w i 

fN CO 

O u 



U 

«4- ~° 



1 Die Muhärib werden auch von anderen Dichtern gelegentlich verhöhnt. 
Daraus darf man nicht etwa folgern, dass dieser, zu den Qais gehörende, Stamm 
von niedrigerer Gesinnung gewesen als die meisten anderen Beduinen, sondern nur 
allenfalls, dass er recht arm und nicht sehr zahlreich war. 



verursacht sein, obgleich auch p^o jw^c (wie ein Taghlabit Agh. 20, 128, 7 heisst) 



2 In der Form p^ob j^a mag die Dehnung nur durch das Versbedürfniss 

3 o 

in dies Metrum hinein gepasst hätte. Die Stelle zeigt aber, dass die Taghlib den 
Namen weder in der traditionellen westsyrischen Form ^Q-*-* j^* noch in der 

ostsyrischen (nestorianischen) ^Q-*-* 1-7^, sondern etwa als ^Q-*~» ^^ gehört hatten. 

7 19* 

o c 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



278 J. Barth. 

man sich stark an die alten Vorbilder. Selbst ziemlich wörtliche 
Nachahmungen von ganzen Versen Früherer kommen bei ihm wie 
bei seinen Zeitgenossen vor. Natürlich beginnen auch Qutämfs 
Qasiden mit dem Nasib. Dass es aber mit seinen Liebesschmerzen 
in Wirklichkeit nicht so arg war, zeigt sich darin, dass wir in zehn 
erhaltenen Gedichten, in denen er eine Geliebte nennt, nicht weniger 
als zehn verschiedene Namen finden. 1 Nur eine dieser Schönen 
i~>5^ erwähnt er in zwei Gedichten (3, 11, 17; 12, 1, 25). Die 
Kameele spielen natürlich auch bei diesem Beduinen eine grosse 
Rolle. Interessant ist da die Schilderung eines widerspänstigen 
Kameelhengstes (xvi, 8 — 15), Eine merkwürdige Stelle, von der ich 
mich nicht erinnere ein Vorbild gelesen zu haben, ist die über den 

o 

Taucher, der Perlen heraufholt (xxin, 13 — 19). 2 Und so kommen 
auch sonst noch einige wenige Stellen vor, die den Eindruck der 
Originalität machen. 3 Wie er aber andrerseits die Ausdrucksweisen 

TD 

gebraucht, die für seine Zeit gar nicht mehr passten, zeigen die 
Stellen, wo er den Monat Öa'bän als heiss iv, 3 und den Muharram 
als feucht in, 27 bezeichnet. So konnten die alten Dichter reden, 
zu deren Zeit die Monate noch feste Stellung zum Sonnenjahr 
hatten, aber die unglückliche Neuerung des Propheten, das reine 
Mondjahr, hatte das geändert. Man könnte freilich daran denken, 
dass der Taghlibit vielleicht noch einen christlichen Kalender mit 
festliegenden Monaten im Sinne habe, zumal auch Achtal gerade so 
von Öa'bän spricht 239, 3. 253, 1. Aber in Wirklichkeit folgen die 
Dichter in der Nennung des Sa'ban als eines Hitzemonats nur alten 
Meistern wie dem Aus b. Hagar 13, 27 oder allenfalls dem Ibn 
Muqbil, der noch die Heidenzeit erlebt hatte Jaq. 1, 551, 8 (und an 
zwei anderen Stellen), wie der Gumädä als feuchtkalt nach dem Vor- 
gange der Alten bezeichnet wird nicht bloss von Hutaia 3, 18. 4 22, 21, 


1 Die Zahl erhöht sich beiderseits auf 11, wenn man xix mitrechnet, in der 
seine Frau ~Jc (für iZSc) vorkommt (v. 1). 

2 Warum der Taucher in der Tiefe Oel ausspeit (v. 18), ist ganz räthselhaft. 

3 Natürlich berühren sich gelegentlich Gedanken und Ausdrücke ganz ver- 
schiedener Dichter. So erinnert in, 38 an Ilias 6, 442 f. 

4 c?^^*: CJ^ri wie ^abid (Huber) 46, 8 ^^Jol^. J^äj. 
E-e 

E =3 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

C _Q 

ü Q_ 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



2 5 



F P. 



Diwan des 'Umeir ibn Schujeim al-QutAmI. 279 

sondern auch von Achtal 63, 9. 175, 7, von dessen Zeitgenossen Rä f i 
Chizäna 4, 251 und noch fast 200 Jahre später von Ibn Mutazz 1, 
54, 5 v. u. Und ähnlich gebrauchen auch andre muslimische Dichter 
die alten Monatsnamen, deren wahre Bedeutung zu ihrer Zeit doch 
Niemand mehr kannte. 

Sprachlich bemerkenswerth sind bei unserem Dichter u. A. 
einige synkopierte Formen wie cu-^io xxix, 57 für C^~i; solche 
finden sich auch mehrfach bei Achtal, so dass man wohl annehmen 
darf, sie waren in der Mundart des Stammes gebräuchlich. — Eine 
merkwürdige Form ist ll*l<~i> m, 52 etwa ,von unedlem Blut' ohne 
- wie £,L?j> oW- ~ <&y> j ene ' i st bis jetzt nur aus Qutäml zu be- 
legen xm, 28 Var. und xxix, 50. — Eine weit auffallendere Dialect- 
form ist *r^ (im Reim) iv, 10 == Lfc/*AJ, wie Tarafa im Reim i^jL, 
19, 7 für Vi)rL und **&L 19, 11 für l^±L sagt (s. ZDMG. 56, 166). 
Denn dass hier, wie der Scholiast meint, der Wein auf einmal als 
Masc. construiert werde, ist undenkbar. 1 Wir haben hier also eine 
Einzelheit aus der Mundart der Rabl r a. 

Irre ich nicht ; so trifft Qutäml auch in der Wahl vieler poeti- 

c o 

scher Ausdrücke mit seinem Stammgenossen zusammen; darin darf 
man aber kaum den Einfluss ihrer Mundart finden, sondern höch- 
stens die Wirkung gleicher Schulung. — Da sich OjjJa. , Weinkneipe' 
für ,Weinwirth' auch sonst findet (s. Barth zu der Stelle), so wird 
man iv, 9 diese Lesart für ursprünglich und (J^^- für eine Correctur 
halten. 2 — J*^L xxm, 17 habe ich auch schon längst, wie Dr. Mitt- 
woch bei Barth zu der Stelle, als , Wogen' gefasst und zu b) ge- 
stellt. 8 Ob es ein Lehnwort oder ein im Dialect erhaltenes altara- 
bisches ist, steht dahin. — Interessant, aber nicht ohne manche 
Analogie, ist &\ 'j*? ,zu stolz sein, um . . /, , verschmähen' in, 57. 



w i 

, O) 
O u 



O o 

c v> 
o 2 



(T3 



2 5 



F P. 



u 

«4- "O 

O <L> 

1 ^LXa^\, das sonst ,nacli dem Preise fragen*, , bieten* heisst, muss hier ,fordern' 
sein. Vgl. den gelegentlichen Bedeutungswechsel von £b und ^cJLSjX. 

2 Wir haben da ein altes Misverständnis eines Fremdwortes wie beim ara- 
maischen (ursprünglich assyrischen) Aä?, das eigentlich , Töpfer* ist, aber im Ara- 



bischen ,Thon', ,Thongefäss' bedeutet. 



3 Ich kannte den Vers aus HarirVs Durra 134, 7 und Chizäna 1, 81. 

.E -ö 
-o v 

E-e 

E => 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



280 J. Barth. 

Agh. 20, 118, 5 v. u. heisst Qutämi ein Jj^. So wird er aber 
gewiss nur bezeichnet, weil verhältnissmässig wenig Gedichte von 
ihm auf die Nachwelt gekommen waren. Der Mann, dem die Verse 
offenbar leicht flössen, wird noch manches Lied verfasst haben, das 
jetzt verloren ist. Auch das Erhaltene ist zum grossen Theil ganz 
fragmentarisch. So macht z. B. xiv, obwohl 30 Verse gross, den Ein- 
druck von Trümmerhaftigkeit. Einige lange Gedichte sind allerdings 
wohl im Ganzen ziemlich gut erhalten. Aus dreien werden im Agh. 
längere Stücke zwar mit Auslassungen, aber in derselben Versfolge 
angeführt, nämlich aus i (Agh. 9, 170 f. und 20, 130 f. 1 ); n (Agh. 20, 
129 f.); xiii (Agh. 20, 128, 130). Dem Verfasser des grossen Werkes 
lagen also wenigstens diese Gedichte wohl in derselben Ordnung 
vor wie uns. Aber bei manchen Liedern Qutämfs zeigt der Sinn, 
dass nicht bloss ganze Stücke ausgefallen sind, sondern dass auch 
die Ordnung der Verse gestört ist. Barth hat sich mit gutem Er- 
folg bemüht, die ursprüngliche Folge herzustellen; natürlich bleibt 
dabei aber vieles unsicher. Auch fremdes Gut ist in das Qutäml's 
eingedrungen, xxi und xxvi, 12 sind von einem etwas älteren Dichter 
Ibn Faswa, s. Barth. 2 

Die Stelle xxm, 20 — 27 ist mir sehr bedenklich, da die darin 
genannten Orte zum Theil südlich von Medina liegen, 3 in einer 
Gegend, die der Taghlibit schwerlich als Schauplatz seiner Liebes- 
abenteuer genannt hätte. Die Verse stören auch den Zusammenhang. 
Aehnlich machen die geographischen Namen die Verse n, 9 — 11 sehr 
verdächtig; freilich stehen sie jetzt in enger Verbindung mit den 
berühmten Worten 13 f. Dagegen ist es mir zweifelhaft, ob Barth 



CÜ 



ti öl 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



«4- ~° 

r^ O) 

N 



<U 



ä s 



1 An der letzteren Stelle ist jedoch, ganz gegen allen Sinn, v. 38 vor v. 19 
gestellt. 

2 So sind in ein Gedicht Zufar's zwei Verse aus einem Gedicht Gamil's ge- 



rathen Tab. 2, 483, 6 — 9 ; s. Agh. 4, 70. 7, 95. 7, 98 f. 7, 109. 19, 13; Harn. 226, 1; 
Jaq. 1, 119. 2, 208. Vgl. noch die Mischung von Pseudo-Tarafa'schen Versen mit 

O) "? 
> <u 

C öl c 

3 «~.*^a)\ und -la^'Jl liegen auf dem Weg von Jathrib nach Bedr, Ibn 



solchen von Hakam b. 'Abdal, worüber ich ZDMG. 66, 168 gesprochen habe. 



Hi»am 433. (0 JLä. (v. 21) soll freilich zu Gazira gehören, aber nach Hamdäni 176, 

25 und Bekrl 329 Ing es in Arabien. 

ld tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 
s_ C 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Diwan des 'Umeir ibn Schujeim al-Qutäm!. 281 

mit Recht annimmt, dass n überhaupt in zwei verschiedene Gedichte 
Qutämi's zerfalle; ich halte es wenigstens nicht für undenkbar, dass 
er in demselben Liede den Sieg der Seinigen über die Qais ver- 
herrlicht, in welchem er den Führer dieser, Zufar, hoch preist. 

Von den wenigen (^ 1 I 2 ) nicht im Diwan stehenden Versen, die 
sonst noch irgendwo dem Qutämi zugeschrieben werden und die 
Barth in einem Anhange giebt, gehört vm dem IJutaia (33, 16) und 
vn auch nach Harn. 26, 3; Agh. 11, 147; Jaq. 3, 49 dem Ga'far b. 
'Olba. Ob von den andern irgend einer wirklich von Qutämi ist, 
halte ich mit Barth für sehr ungewiss. 

Mit ungewöhnlicher Belesenheit in gedruckten wie in hand- 
schriftlichen Werken hat der Hg. die Citate aus Gedichten Qutämi's 
gesammelt und dadurch den kritischen Apparat bedeutend vermehrt. 
Ich kann nur vier hinzufügen: v, 6 = Ibn Walläd 119, 6; xn, 15 = 
Jaq. 3, 268, 8; xxm, 16 = IJarlrl's Durra 34, 7; xxix, 50 b = Gauh. ü. 

Dem Hg. standen zur Verfügung ein Berliner Codex (B) und 
anfangs eine, später zwei Abschriften eines Cairiner (C), die aber 
die Vocalisation dieses nur zum kleinsten Theile wiederzugeben 
scheinen. Die Berliner Handschrift ist vom Jahre 364 d. H., also 

l_ in / 

sehr alt, aber doch lange nicht so gut, wie man erwarten sollte. 

in ^ 

Auch die Cairiner ist alt, vom Jahre 582. B und C stimmen in der 
Zahl der aufgenommenen Gedichte nicht ganz überein und weichen 
auch sonst manchmal von einander ab. Barth hat den Text im 
Wesentlichen nach B gegeben, aber alle Varianten von C sorgfältig 
angeführt. 

Nur an wenigen Stellen möchte ich mit einiger Sicherheit eine 
andre als die vom Hg. gewählte Aussprache des Textes vorschlagen 
oder unter den überlieferten Lesarten eine andre auswählen. 

iv, 15 lese ich *j&f- j**? ,mit leeren Kröpfen' oder auch j*-*? 
*j3\j* ,mit leeren Säcken'; die ,Säcke< ständen dann bildlich für die 



0} 

"U 



.c o 



o E 



F P. 



u 

«4- ~° 

O <L> 

*S 

'in öi 

Kröpfe. Die Vögel sind ausgehungert wie von Durst geplagt. Das 
scheint mir hier viel besser als SISU* ^i^ ? mit gelben Schnäbeln'. 

CO 



vi, 28. Die Var. ist wohl zu lesen l-a^U^», PI. von iS^^. 

9 

l-ä^m^o ist der, dessen Habe zu Grunde gegangen ist Agh. 13, 140, 

.E "ö 
-ö v 

E-e 

E => 

fD O) 
s_ C 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



282 J. Barth. 

12; Chizäna 2, 290; Abu Zaid 75; Schol. Hudh. 1, 5; Gauh. ^y*. 
Das konnte leicht aufs Land übertragen werden. 

xi, 4 halte ich an dem überlieferten a£» . . ■ t^ojlaJ fest. Der 
Accusativ könnte doch nicht von ^^ v. 1 abhängen. Das ist zu 
entfernt, die doppelt transitive Construction von jl* wäre äusserst 
auffallend, und wir erhielten doch keinen guten Sinn. V. 4 ist m. E. 
in sich abgeschlossen; der Nom. ist das halb determinierte \*xZ*-* des 
durch C dargestellten j^>-. Dass der Vers nach vorn und hinten 
keinen Anschluss hat, bleibt bestehen, aber wie oft ist das gerade 
in diesem Diwan der Fall! 

xv, 2 und xxiii, 11 möchte ich >'/> beibehalten; die Zähne werden, 
meine ich, geradezu ,Hagel* genannt. 

xv, 26 lies das vom Reim geforderte «-r^^-. Dies ist eben 
,fremd' = urC ^4 te \. Ganz so Harn. 112, 6 v. u. und Hätim (Schulthess) 
pg. 17, 17. Also ist auch Harn. 196 v. 1 <-^^- richtig. Vgl. noch 
Kämil 437, 15. Dagegen ist ^o^ ,kleiner, dicker Kerl' Amrlq. 4, 4; 
'Alqama 1, 23; Hudh. 104, 1 (vgl. Schol. Hudh. 74, l); Gamhara 
147, 18 (s. die Var.); ebenso J^^4- Labid (Chälidi) pg. 10, 5. 1 

xv, 31 lies «<^J\ ^U^. Als qualificierender Genitiv steht £ y^ } 
*5^Jl (= xi^)'. So z. B. *y* ?£ Süra 21, 74, 77 ganz wie Kitf Tio 
Ps. 26, 4; Job 11, 11. Wenn Süra 9, 99. 48, 6 für *^J\ *y\> ,die 
üble Wendung' manche lesen *y~^\ ayb, so beruht das auf einer an- 
deren, und wohl richtigeren, Auffassung: ,Wendung des Uebels/ 

xvi, 9 wohl V!/^; PI- von ^3* . • t^ ma g e * n Adjectiv, etwa 
yf3 sein. 

xvn, 6 würde ich die Lesart ^iloJl ,den elenden' der aufge- 
nommenen joiLojJl ,den (körperlich) Unansehnlichen' entschieden vor- 



CÜ 



t! öi 



w l 

fN CO 
f\l ^ 
, O) 

O o 

* 



ziehen. 



xix, 15 lies ^>^\ S^*- y anzünden, schüren' Amrlq. 46 ; 15; 
Aus b. Hagar 16, 5; 'Antara, Mo. 32; Hudh. 92, 56; Gamhara 167, 9. 
xxii, 2 vielleicht ^A>^ ,habe erzogen, belehrt', 
xxn, 9 ist *j*^ ? letzte Nacht eines Monats' (s. Gauh. j*? 9 wo 



u 

- O) 
_N 
'-I-J 

> <u 

=) O 
" ° 

noch andre Formen und ein Vers, der die Anwendung erklärt) ganz 



1 So wird auch Ibn Dor., Istiqäq 130, 12 v_^oti.\ zu lesen sein. 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Diwan des 'Umeir ibn Schujeim al-QutämI. 283 

richtig. Die Frauen wählen diese gänzlich mondlose, dunkelste Nacht 
als Deckmittel ^l^- gegen alle Späher. *>^ hat schwerlich eine 
hier passende Bedeutung. 

xx, 9 lies IfXLiZ» (Druckfehler). 1 

xxix , 83 vielleicht <»«iXJt (Activ). Gauh. und Qämüs haben 
cU-tsi und Jxi-i* von der Dattelpalme. Die Entwicklungsstadien der 
Dattel werden als Thätigkeit des Baums oder der Frucht aufgefasst, 
vgl. Harlrl, Durra 42 f. Doch hat Ibn Hisäm 656, 5 sowohl Wüsten- 
feld's Ausgabe wie unsre sehr gute Handschrift <*^XJ\. Und im 
1. Stamm sicher %S Achtal 242, 10 und ?*-*£* Labid (Chälidi) 93. 

In den Bemerkungen des Hg.s zu i, 8 (S. 2) ist das Reimwort 
J^/i-^ zu lesen. Die meisten Verse, die hier und da aus diesem 
Gedicht des c Adl b. Zaid citiert werden, haben allerdings Reim Wörter 
im Genitiv, aber JE AS 1900, 360 sind auch solche im Acc. und 
Nom. Und auch ohne das verlangt das Metrum die Vocallosigkeit. 

Die ziemlich spärlichen Scholien der beiden Handschriften bieten 

im Wortlaut und selbst inhaltlich manche Verschiedenheit. Auch in 

jeder einzelnen Handschrift sind sie heterogen und von ungleichem 
£ g 

Werthe. Freilich helfen sie uns in sehr dankenswerther Weise zum 

i- g 

Verständnis des Dichters, aber nicht selten sind sie oberflächlich 

in ^f. 

und zuweilen ganz unrichtig. So wenn in, 33 die von den Banü 
Nabhän ausgesandten Jäger als Hunde aufgefasst werden, während 
Hunde doch erst im folgenden Verse als Begleiter der Jäger er- 
scheinen. Oder wenn xx, 11 einfach in \j*** JuT\ ein ^\ ergänzt wird 
,sie wollte nichts als Scham', während natürlich mit Barth zu über- 
setzen ist ,sie weigerte sich aus Scham'. 

Die durchweg knappen Anmerkungen des Hg.s sind sehr will- 
kommen. Ich hätte allerdings gern noch etwas mehr Erklärungen 
gehabt. Am liebsten wäre es mir gewesen, er hätte eine vollständige 
Uebersetzung gegeben. Freilich trägt ein Uebersetzer altarabischer 

■J75 öi 

Gedichte seine Haut zu Markt und kann sicher sein, dass er manche 
Fehler macht, die Andre leicht verbessern; das weiss ich genügend 



w i 

fN CO 

O u 



O o 

c v> 
o E 



F P. 



=) o 

— o 

CO 

1 Einige wenige andere Druckfehler wird sich jeder Leser selbst verbessern. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



t! öi 



284 J. Barth. 

aus eigner Erfahrung: aber diese einfachste Art, seine Auffassung 
jeder Stelle zu zeigen, ist doch die zweckmässigste. 

Bei wenigen Versen nehme ich an Barth's Erklärung Anstoss. 

ii, 25 ist m. E. <J»^i\ nicht mit dem Scholion als Ortsname 
zu fassen. Ich übersetze: ,frage die (alle) Nizär, die ja viel mit 
mir gekämpft haben, um Billigkeit zwischen Heiss- und Kaltmachen 
(d. h. um ein unparteiisches Urtheil).' Achtal 215, 9 ist ^Jcoi ein- 
fach ,Hälfte< wie eb.^i*' ,ZehnteK 

ii, 52 finde ich jLj nicht in der Bedeutung von f-***- passend. 
Der Scholiast denkt allerdings an Stellen wie Chansä 10, 12 und 
Achtal 189, 8, 1 aber schon ^^r*^ ^} c Antara 7, 12 geht schwerlich 
auf diese Art von ^Schwerwiegend und an unserer Stelle ist J^* J^j 
*ULUl ,beim kriegerischen Zusammenstoss schwer (auf den Feinden) 
lastend*. ^A^Jl ^ 5ij^*~* bezeichnet im Gegensatz dazu das Ver- 
halten gegen die Stammgenossen. 

vii, 6 sind JjoULI trotz des Scholions Kameele wie Chansä 10, 10 
und wohl auch Näbigha, ed. Derenb., Compl. pg. 46, 4 = A<Jdäd 
37, 5 v. u. Denn v. 7 zeigt diese jo3UA.I im Wettlauf mit ,den 
schlanken an ihrer Seite*; das sind aber sicher die Rosse. Diese 
werden ja unbelastet an der Seite der Reitkameele geführt, bis man 
auf den Feind stösst. Die Lesart >$*>., die nur auf Pferde passt, 
ist also in v. 6 falsch und mit der Var. j*£ zu vertauschen, o^i 
kommt zwar meist vom Pferde vor, aber auch vom Kameel Harn. 402 
v. 1 (wie auch vom Menschen A'ää in Lyall's Mo'allaqa-Ausg. S. 143 
v. 2. [öfter citiert]). 

xiv, 1 ist kein *\ji[ } denn i^z+X^A würde ja auch nicht auf 
^JLu) reimen, da dem Worte das a des j^^ü' fehlt. 

In der Anmerkung zu xiv, 13 (S. 26) wäre ^*bU oder f-fS>lft 
für r*3>\* zu schreiben. 

xiv, 27 möchte ich «^-o ; in meiner Person i erklären; dann 
passte alles gut. Freilich habe ich keine genaue Parallele für eine 

■- ü 

solche Verwendung von ^ zur Hand (wie sonst wohl v> steht). 



1 Diese Stelle hat wohl Gauh. **.. im Auge. 

.E -ö C* 

-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



Cl 



03 



Diwan des 'Umeir ibn Schujeim al-QutämI. 285 

xxiv, 20 scheint mir die Deutung, welche der Scholiast von $j* 
giebt ,mit kleinem Höcker' richtig. Die Lexika bieten allerlei Ab- 
leitungen von yj in entsprechenden Bedeutungen. Ich erkläre die 
Schlussworte: ,so würde man sie nicht melken (sondern schlachten).' 
— Was aber im Scholion für L^U ^^ zu lesen, ist mir unklar. 
L^-ifi «üuLir wäre ungrammatisch für L^ ^-Jutir . 

xxix, 57 ist ,3äUL£> nicht , Gebrüll', sondern der PI. von ^-4sJL£> ? 
der Blase, die dem Kameelhengst (jj» v. 56) bei der Brunst zum 
Maule heraushängt, j^ka steht gerade auch vom Laut des brünstigen 
Kameeis Asma'l, Farq 18, 15; Hudh. 279, 24; Harn. 193, 7 (wo der 
brünstige Mensch mit dem Kameele verglichen wird). Das Gebrüll, 
das Chizäna 4, 314, 1 ein JJ^^ä-^ }> ausstösst, wird hier den ^^iULä 
selbst zugeschrieben. 

Unklar ist mir u. A. noch xxix, 95. Ich verstehe hier weder 
j^, noch die Glosse v_-ai-^. Auch mit der Aenderung J^ käme 
man kaum zu einem passenden Sinn. So bleibt denn auch unsicher, 
wie ^wXft auszusprechen ist (\}<^* ?). 

Da der Umfang des Diwans nicht gross ist, so kann ein Reim- 
index, der sonst keiner, nicht alphabetisch geordneten, Ausgabe ara- 
bischer Gedichtsammlungen fehlen sollte, entbehrt werden. — Die 
äussere Einrichtung des Werkes ist auch in Kleinigkeiten sehr zweck- 
mässig, z. B. in der Anbringung der Ziffern als Columnentitel. Im 
Druck fallen einige J mit weit vom Corpus des Buchstaben ent- 
ferntem Punct auf. Sonst ist Druck und Papier des altberühmten 
Namens ,Brili/ durchaus würdig. 

Der Wiener Akademie sind wir dafür, dass sie das Erscheinen 
dieser trefflichen Ausgabe ermöglicht hat, zu grossem Dank ver- 
pflichtet. Es könnte allerdings befremden, dass das Werk des Ber- 
liner Gelehrten nicht von der Berliner Akademie unterstützt worden 
ist; aber wenn man weiss, dass ein so hervorragender Arabist und 



ti öi 



O) 

o u 



O o 

c v> 
o E 



ru 



2 5 



F P. 



u 

«4- ~° 



bewährter Lehrer wie Barth seit langen Jahren Professor ohne Ge- 

> Q) 

halt ist, so kann man nur sagen ,legt's zu dem Uebrigen'. 

Strassburg i. E. Th. Nöldeke. 



.E -ö 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



286 MunkAcsi BernAt. 

MunkAcsi BernAt. Arja es kaukdzusi elemek a finn-magyar nyelvek- 
ben. I. kötet. Magyar szöjegyzek s bevezet^stil: A kerdes törtenete. 
Irta — . Budapest, 1901. SS. vh, 672. 8°. 

MunkAcsi untersucht ,die arischen und kaukasischen Bestand- 
teile in den finnisch-magyarischen Sprachen', und zwar in dem vor- 
liegenden ersten Bande diejenigen welche sich auch oder nur im 
Magyarischen finden; diejenigen welche sich nicht im Magyarischen, 
sondern nur in den verwandten Sprachen finden, sind einem andern 
Bande vorbehalten. Die lange Einleitung (117 S.) gibt eine ge- 
schichtliche Darstellung der Vorarbeiten, über die M.s eigene Arbeit 
dem Umfang und der Art nach weit hinausreicht. Es ist ein bisher 
mehr geahntes als erschautes Gebiet in das, und bis zu dessen Herzen, 
er eingedrungen ist. Der Kühnheit die hier nötig war, hat sich me- 
thodische Gründlichkeit zugesellt, und wiederum gesellt sich dem 
durch diese berechtigten Sicherheitsgefühl das für das grosse Ganze 
gilt, eine Bescheidenheit zu die in Bezug auf jedes Einzelne Be- 
richtigungen anzunehmen bereit ist. Dieser erste Band mit seinen 
400 Artikeln ist nächst dem vor zwei Jahrzehnten erschienenen 
BüDENzschen Vergleichenden Wörterbuch der wichtigste Beitrag zu 
dem letzten der grossen magyarischen Wörterbücher, nämlich dem 
etymologischen, welches auf die schon veröffentlichten, das sprach- 
geschichtliche und das mundartliche, und das erst in Angriff genom- 
mene Grosse Wörterbuch folgen wird. Aber auch innerhalb der ge- 
samten finnisch - magyarischen Sprachforschung nimmt M.s Werk 
einen hervorragenden Platz ein; und seine Bedeutung ist schliesslich 
eine noch allgemeinere, indem es sich auf zwei andere grosse und 
wichtige Sprachgruppen erstreckt, und auf die Geschichte der be- 
treffenden Völker selbst, d. h. soweit es sich um deren Wohnsitze 
und Kultur handelt. Es sei ihm hier eine einseitige Beleuchtung 
gewidmet, nämlich vom Standpunkt der kaukasischen Sprachwissen- 



CÜ 



ti öl 






.03 






F P. 



u 

«4- ~° 

_N 
'-I-J 



s 1 

schaft aus. 

=> o 

*— o 

S. 100 sagt M.: ,Wir haben diese beiden Aufgaben [die Auf- 
zeigung der arischen und die der kaukasischen Bestandteile der 

in lh 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Ärja es kaukAzusi elemek a finn-magyar nyelvekben. 287 

finnisch-magyarischen Sprachen] miteinander verbunden; denn beide 
gehören den vorgeschichtlichen Zeiträumen unserer Sprachgeschichte 
an, und soviel sich auf dem heutigen Standpunkt der Forschung 
vermuten lässt, haben jene kaukasischen, bezugsweise heutzutage in 
den Kaukasusgegenden wohnenden Völker deren sprachlicher Ein- 
fluss in den finnisch-magyarischen Sprachen bemerkbar ist, gewiss 
auch einen geschichtlich zusammenhängenden Kreis mit jenen ari- 
schen Stämmen gebildet von welchen der beträchtlichste Teil der 
arischen Bestandteile der finnisch-magyarischen Sprachen herkommen 

mag Es liegen bestimmte Spuren davon vor dass arische 

Bestandteile durch Vermittlung kaukasischer Völker zu den Finnen- 
magyaren gekommen sind, und ebenso von dem umgekehrten Fall/ 
Aber nicht bloss über die Berührung zwischen Arisch und Kau- 
kasisch hätte sich M. aussprechen sollen, sondern auch über die 
innere Lagerung von beidem, ob sie einander gleichartig ist oder 
nicht, ob wir A + B oder A -f- ß vor uns haben. Der Ausdruck 
,kaukasische Sprachen' deckte zunächst einen geographischen Be- 
griff, von dem aber bald die uralaltaischen, semitischen und arischen 

c o 

Sprachen abgetrennt wurden. Nachdem noch Fr. Müller über die 
Verwandtschaft oder Nichtverwandtschaft zwischen sämtlichen kau- 
kasischen Sprachen nicht sich zu entscheiden getraute, erachtet sie 
Erckert als , miteinander so innig verwandt dass sie Abkömmlinge 
einer in ihnen aufgegangenen [?] Ursprache zu sein scheinen/ Ich 
glaube nicht dass hier das Wort ,innig' am Platz ist, und ich glaube 
auch nicht dass eine kaukasische Ursprache sich überhaupt erdenken 
lässt, wie das doch mit einer arischen der Fall ist; aber ich setze 
mich nicht in direkten Widerspruch zur ERCKERTSchen Behauptung. 
Die Sache ist die dass wir mit unsern bisherigen Benennungen und 
Vorstellungen nicht mehr auskommen; es sind Umtaufen und Um- 
wertungen notwendig. Vor allem müssen wir uns von der Gewohn- 



w i 

fN CO 

O u 



O o 

c v> 
o E 



(T3 



2 5 



F P. 



u 

«4- ~° 



heit befreien die Verwandtschaft der Sprachen in einem festen Pa- 
rallelismus mit der Verwandtschaft der Völker zu denken ; wir haben 
ja längst beobachtet wieviel ,Entlehntes* überall zum ,Ererbten' hin- 



a> «fl 



zutritt, ja dass ganze Sprachen entlehnt werden können. Und wenn 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



288 Munkäcsi Bernät. 

unsere Blicke in vorgeschichtliche Zeiten zu dringen versuchen, wo 
wir die Reiser nicht mehr erkennen an welche die Sprachen ge- 
bunden sind, dann verschwimmen für uns auch Entlehntes und Er- 
erbtes ineinander. Immer beginnen wir damit zwischen einzelnen 
Erscheinungen verschiedener Sprachen überhaupt eine Verwandt- 
schaft festzustellen, deren bestimmte Form uns nicht sofort klar ist; 
aber wir dürfen auch nicht übersehen dass nicht jede Verwandtschaft 
für uns erkennbar zu sein braucht, dass wir somit, wenn wir von 
den Sprachen selbst reden wollen, nie beweisen können dass solche 
miteinander nicht verwandt sind. Bopps Versuch die kharthwelischen 
Sprachen der arischen Familie einzuordnen mag noch so verfehlt 
sein, bestehen hier nicht vielleicht mehr Uebereinstimmungen aus 
denen man auf eine Verwandtschaft zu schliessen vermöchte als 
zwischen dem Kharthwelischen und sagen wir z. B. dem A warischen? 
Fassen wir aber jene als Ergebnisse einer späteren Berührung, was 
hindert uns eine solche nicht auch in dem zweiten Falle anzunehmen, 
statt einer Gemeinsamkeit des Ursprungs? Obwohl M. von den beiden 
Sprach kr eisen redet (S. vi. 117), so tut er das kaum aus Vorsicht, 
er scheint sich die Ansicht Erckbrts angeeignet zu haben. Denn 
er erklärt: wenn er zu einem magyarischen Wort ein Wort aus 
einer arischen oder kaukasischen Sprache vergleiche , so bedeute 
das keineswegs dass diese als die unmittelbare Quelle anzusehen sei, 
sie vertrete nur den ganzen Kreis. Und dass ihm die Verbreitung 
einheimischer Wörter innerhalb der kaukasischen Sprachen nicht 
etwa als Gegenstück zu der ausserordentlichen Verbreitung arabischer, 
persischer und türkischer auf diesem Gebiete vorschwebt, wird schon 
daraus offenbar dass er verschiedentlich auch gemeinkaukasische 
Wortbildungen ansetzt. In der Erwägung der kaukasischen Zusam- 
menhänge geht er nun weit über die Bedürfnisse seines eigentlichen 
Zweckes hinaus, er widmet sich ihr mit besonderer Vorliebe, und 






w I 

fN CO 

f\l ^ 

, O) 

° m 



c v> 
o E 



F P. 



u 

«4- ~° 

O <L> 
> S 

die betreffenden Teile seines Buches verdienen vollauf von den 
Kaukasiologen beachtet zu werden. Als eigentliche Grundlage dient 
ihm dabei begreiflicherweise das ERCKERTSche Polyglottenwörter- 
buch, jene Sammlung von Wörtern aus 30 Sprachen oder Mundarten 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Ärja es kaukAzusi elemek a finn-magyar nyelvekben. 289 

für über 500 Bedeutungen, die uns noch dankenswerter sein würde 
wenn sie mit grösserer Sorgfalt ausgeführt wäre. M. hat sich keines- 
wegs mit der Wiedergabe des hier Zusammenstehenden begnügt, er 
hat die Bezeichnungen verwandter Begriffe herangezogen und die 
lautlichen Verschiedenheiten der Wortformen durch möglichst zahl- 
reiche Analogien zu begründen sich bemüht. Er hat auch andere 
Quellen benutzt; unter diesen vermisse ich aber den so reichhal- 
tigen CöopmiKz MaiaepiaJiom öjir ouucanin Mbcmnocmeu u ujiCMenz 
Ka6h(i3a, von dem vor kurzem schon der 29. Band erschienen ist, 
und A. Tsagarelis MtmepeJtbCKic Smiodhi, deren zweites Heft eine 
sehr ausführliche Darstellung des mingrelischen Lautsystems enthält, 
mit beständiger Vergleichung des Georgischen, freilich ohne den Ge- 
winn eigentlicher ^Lautgesetze'. Gute Dienste würde auch Töubinows 
Wörterbuch geleistet haben, besonders der russisch-georgische Teil. 
Warum im Quellenverzeichnis S. 116 gerade nur der dritte Band 
von Uslars BaiHoepafßin Rawam angeführt ist, errate ich nicht. Um 
es nun kurz zu sagen, so tritt uns eine über alle kaukasischen 
Sprachen sich erstreckende lexikalische Verwandtschaft, die schon 
ein flüchtiger Durchblick der ERCKERTSchen Wörter Verzeichnisse ver- 
muten lässt, bei MunkAcsi in weiteren und festeren Umrissen entgegen; 
dass damit die Verwandtschaft schlechthin erwiesen sei, leugne ich: 
die südkaukasische Grammatik hat nur weniges mit der nordkau- 
kasischen gemein, und hier ist Verschiedenheit der Ursprünge nicht 
unwahrscheinlich. M. hat eine ungeheure Menge von Tatsachen 
zu überblicken gehabt und daher aus einer zu fernen Höhe als dass 
nicht bei näherer Betrachtung sehr vieles in anderem Lichte er- 
scheinen müsste. Ich begnüge mich mit ein paar Beispielen. 

S. 453 stellt M. magy. magas ,hoch' zum gleichbed. georg. laf. 
mayali, 1 mingr. moyali (das o ist sekundär). Man hatte sowohl jenes 

«4- ~° 



1 Das aus dem Georg, noch angeführte maylaC ist Adverb. Bei Erckert 
sind unter den Adjektiven recht verschiedene Ausdrücke zusammengeworfen, so N.412 
,alt 4 : georg. moxut 8 ewvlia [lies -bulia; ist alt], beberia [ist eine Greisin]; 413 ,arm': 
mingr. yaribi wortU [ich bin arm]; 414 ,billig*: georg. iapia [ist billig], iapuC 
[lies -aC; billig Adv.]; 417 ,breit': georg. part'ob [lies p'art'od; breit Adv.], ga 

£ -o 
-ö v 

E-e 

E => 

ro <V 

cn x: 
in -m 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



CÜ 






T3 



O o 



F P. 



290 MunkAcsi BernAt. 

wie dieses auf ein bekanntes arisches Wort: \ii^<xq u. s. w. bezogen; 
M. erwähnt dies nicht einmal, mit Unrecht, da der eine Zusammenhang 
den andern nicht ausschliesst. Er scheint allerdings das Wort für 
ein echt kaukasisches zu halten, und zwar für dasselbe (-U ist sicher- 
lich wortbildend) wie ud. bo%o ,hoch', ,lang', thusch. bo%o ,gross', 
dfchek. bugud, lak. b^o%^tul ,hoch'. Aber in der thuschischen Form 
ist b Motionskonsonant; das Adjektiv lautet bald d-o%o, bald w-o%o, 
bald j-0%0, bald b-o%o und wäre somit kurzer Hand .o%o zu schreiben. 
Das Tschetschenische, von dem ja das Thuschische nur eine Ab- 
zweigung ist, hat für ,gross' .o%%ur] (aus diesem und der einen be- 
stimmten Form wo%%ur] ist bei Erckert 9 axkxküng, vöqun' geworden). 
Auch das Substantiv zeigt diesen Wechsel des Anlauts, je nachdem 
es sich auf einen Mann, eine Frau, eine Sache, eine Mehrzahl be- 
zieht: thusch. tschetsch. d-o%ol, d-o%%ula) w-o%ol, ic-o%%ula u. s. w. 
Jedenfalls lautet das Wort für sich vokalisch an; ob, wenigstens beim 
Uebertritt in eine andere Sprache, ein Motionskonsonant fest mit einem 
solchen verwachsen oder umgekehrt dem stammhaften Konsonanten 
im Anlaut eines Adjektivs die Rolle eines Motionskonsonanten zu- 
geteilt werden kann, bleibt zu untersuchen. Hierher gehört nun sicher 
auch tabass. ayur, agul. a%af ,gross', sowie chürk. a%, a%il, kait. 
akusch. a%il } tsach. aytuna ^hoch'. 1 Vielleicht sind weiter anzuknüpfen: 
lak. la% ,hoch', la%i ,lang', thusch. la%H ,hoch' (la%ol ,Höhe'), artsch. 
larirtut ,hoch', layotut ,lang' (-tut ist hier eine häufige Adjektiv- 
endung), tschetsch. lept] ,hoch', .ie%irj ,lang'. Es müsste dann l als 
ein ursprünglicher Motionskonsonant angesehen werden, in welcher 

Rolle es einige Sprachen kennen; vgl. noch kür. lat 8 u* tabass. lit s ü y 



* i 

niwrah [lies -ad; breit Adv.], yatfieri [lies ganieri], 418 ,dunkel': georg. Cbilia [ist 



CÜ 



t! öi 



TD 
Q. 



03 






F P- 



warm] u. s. w. 



1 Erckert gibt auch ein abch. ah ,hoch*. Aber das beruht offenbar nur auf 
der von Uslar dmn. Kiigk. i, 120 ausgesprochenen Vermutung, das abch. ah ,regie- 



«4- ~° 

O <L> 

render Fürst* habe ursprünglich die Bed. ,hoch% , gross' gehabt, was sich aus der 



Vergleichung mit ejhä [mehr] und harbk [hoch] entnehmen lasse. 

2 Ich drücke die zusammengesetzten Laute, auch wenn sie in der georgischen 
und in andrer Schrift durch einfache Zeichen wiedergegeben werden, durch zu- 
sammengesetzte Zeichen aus; nur verkleinere ich dann immer das zweite. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



T3 






Arja es kaukäzusi elemek a finn-magyar nyelvekben. 291 

lizu, lizib, bud. dfchek. lazu mit chürk. kait. akusch. t 8 uwa, kub. i* Ä w&- 
ziw, and. &a< 8 a, karat. hat s ab ,weiss'. Durch das Angeführte wird der 
Zusammenhang zwischen mayali und boyo sehr unwahrscheinlich 
gemacht. 

S. 121 Anm. stellt M. zusammen kub. wark. mat 8 a y mat 8 a und 
georg. mttficari, laf. mt§yuri ,Sehaf. In jenem, dem noch anzufügen 
sind akusch. chürk. maza, kait. mat 8 a y mart s a, tabass. marts(a), ist 
das m- stammhaft, in diesem ist es das Präfix des Partizips, welches 
ja zuweilen schwindet, z. B. georg. p'rinweli = mp'rinweli , Vogel'. 
Bei TSübinow finde ich nicht einmal mi 8 ywari, sondern nur t 8 yowari, 
t 8 %wari, welches eigentlich gebend' bedeutet (t $ %owreba ,leben'), ganz 
so wie t s xoweli gebend' und ,Tier'. Dass das Schaf schlechtweg als 

o 

Tier bezeichnet worden ist, darf nicht Wunder nehmen; auch in 
rom. Mdd. gilt bestia für das Schaf. Uebrigens hat auch das Min- 
grelische das Wort ohne m~: £#im; so laf. tfturi neben m-. 

In ähnlicher Weise hat M. S. 443 die erste Silbe von swan. li- 
panal ,fliegen' verkannt, welches er zu magy. lepke ,SchmetterIing' 
vergleicht. Ein flüchtiger Blick in Erckerts Buch musste ihn doch 
belehren dass jeder swanische Infinitiv mit li beginnt. Es ist abzu- 
teilen: li-pan-al, und es liegt hier wohl derselbe Stamm vor wie 
in dem wesentlich gleichbed. li-per, li-per-iel und georg. p'rena. 
Auch das trifft nicht zu dass, wie M. in der Anm. behauptet, -nal 
hier die Endung ist; es ist dies vielmehr -aZ, wie in li-br-al ,sich wa- 
sehen' (georg. bana), li-wzir-al ,raten' (georg. weziroba), li-yr-al ,singen' 
(georg. myera), U-mbw-al , erzählen ' (georg. amboba), und insbeson- 
dere in den von M. angeführten li-t s wn-al , lachen' (georg. t 8 ineba) 
und U-gn-al ,stehen' [und , stellen'], dessen Nebenform ligne schon 
hätte aufklären sollen. Damit ist nicht gesagt dass das -n- nicht in 
letzterem und in andern Fällen sekundär wäre; man erwäge l§-g 
,er steht' gegenüber von l§-gan ,er stand', ad-gan-e ,er stellte'. Viel- 
leicht hat -n- ursprünglich faktitive Bedeutung, wie im georg. a-dgen-s 
,er stellt' gegenüber von dga-s ,er steht'. Vgl. li-gwra-n-al J,(sich) 
rollen' (georg. gorwa), li-k* wt* -un-al , bewegen' zu lik'wt'-une dass. 
u. s. w. 

Wiener Zeitschr. f. d. Kjinde d. Morgenl. XVI. Bd. 20 

E-e 

E => 

(ü <D 
in 4-/ 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

fN CO 

O u 






o 2 



F P. 



u 

«4- "O 

O <L> 

CT 



292 MüNKÄcsr BernAt. 

Ueberhaupt hat M. eine gar zu leichte Hand bei der Zerschnei- 
dung der Wörter, die ja eine gründliche Kenntnis der einzelnen 
Sprachen erheischt; so setzt er S. 489 georg. na-t'eli ,hell' statt nat'- 
eli, S. 620 laf. %odii ,Ochs' = *%or-dgi statt = *%ori, georg. yari (dem 
georg. -ri entspricht mingr. laf. -dji, so auch mingr. %odzi; mingr. 
geri ist nicht = georg. x ar h sondern = georg. mgeli — Erckert hat 
russ. sojiz für sojikz verlesen) u. s. w. 

Wenn auf ein Wort zwei Wörter einer und derselben andern 
Sprache bezogen werden, so heisst das so viel wie dass diese beiden 
miteinander zusammenhängen. Das ist aber ausgeschlossen bei abch. 
mingr. kwata, georg. kwate ,Ente* und georg. k'at'ami, mingr. h'ot'omi 
(so, nicht kat'ami, kot'omi) ? Huhn', ,Henne' (nicht ,Hahn'), welche 
von M. S. 298 zu magy. goda , Wasserhuhn', guvat > ,Wasserralle' 
verglichen werden. Kwata scheint eigentlich ein mingrelisches Wort 
zu sein; als georgisches und abchafisches finde ich es sonst nicht 
verzeichnet, die Ente heisst dort iywi und hier papi (oder p'apH, 
nach Staröewskij: muu). Wahrscheinlich ist es nichts anderes als 
das arab. batta ,Ente' (welches im Georg, bati mit der Bed. ,Gans' 
fortlebt; daher thusch. bäd dass., aber tschetsch. bäd ,Ente'), im An- 
laut durch den Entenschrei umgeändert, der wenigstens den Deut- 
schen als quack quack erscheint. Dem Gackern oder Glucken der 
Henne aber entstammt k'atfami. Jenes heisst georg. kakaneba (arm. 
kakanel, gr. xay.y.a(siv, russ. kokouzz, franz. caqueter, span. cacarear 
u. s. w.), welchem ud. kokot s \ chinal. kukat s ,Huhn' zunächst stehen; 
vgl. talysch. (iran.) kak, kjak dass. Für das zweite k findet sich nun 
auch t oder d, nicht in Folge von Dissimilation, sondern weil un- 
mittelbar gehört, so russ. Kydaxmamb, poln. gdakac, rum. codcodäci, 
magy. kotyogni } kotlani, koddcsolni, franz. cadaquer u. s. w. Dazu 
gehören rutul. kat, tsach. katje, tscherk. (kab.) ged (aber in der 
abadf. Md. bedeutet ketii ,Hahn', und davon ist keti-bs ,Huhn' erst 



CÜ 



ti öi 



w i 

fN CO 

° m 



o E 



CD 



F P. 



u 

O <L> 
■4-J ±1 

abgeleitet), abch. kut§ ,Huhn'; vgl. neusyr. (urm.) k'yt'et'e dass. u. a., 



> <u 

=> o 

— o 



auch lad. cot, cod = franz. coq ? Hahn'. Ferner, mit nicht ganz klaren 
Erweiterungen, swan. k'at'al, georg. k'at'ami. M. denkt bei der 
zweiten Hälfte von k'atfami an ein Wort das .Vater' bedeutet, und 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Ärja es kaukäzusi elemek a pinn-magyar nyelvekben. 293 

das wäre für ,Hahn' zulässig (so heisst ja in der That der Hahn im 
Georgischen mamali von mama , Vater'); aber k'at'ami bedeutet, wie 
gesagt, ,Huhn'. Aus dem Georgischen drang das Wort ins Thuschi- 
sche und Tschetschenische ein. 

Auch S. 285 vermengt M. die Namen zweier ganz verschie- 
denen Vögel, die ihrem Ruf entnommen sind, und sieht in ihnen die 
Abbilder eines Sanskritwortes welches , Vogel' i. A. bedeutet: kür. 
liway, artsch. quakk [ein solches Wort steht nicht bei Erckert 
i, 115, wohl aber artsch. yoan und gleich darauf als tschetsch. ar- 
cin-qakk, qikk 7 das Ergebnis irgend einer Verwirrung], georg. qwawi 
,Rabe', tschetsch. %o%u, thusch. %au% /Taube', lak. %'^agu ,Elster*. 
Der Ruf der Taube ist rukuku, kuku (vgl. d. gurren, engl, coo); 
darauf gehen die beiden angeführten Wortformen, sowie and. koyo, 
abch. h w §h w , lak. lii zurück; das ud. gögär stammt aus dem Tatari- 
schen. Es kommen aber in den kaukasischen Sprachen auch dem 
Anschein nach nicht lautnachahmende Namen der Taube vor, so 
chürk. lawha, kür. luf — awar. mikyi, swan. mugw — georg. (m)tredi 
u. a. Noch deutlicher ist der Ursprung jener kaukasischen Namen 
für ,Rabe' (die sich bedeutend vermehren lassen) und ,Elster'; das 
wotj. kwaka ,Krähe' und die zahlreichen tibetischen, nepalischen und 

in ^ 

indischen Wörter wie käk, kwäk mit derselben Bedeutung, die M. an- 
führt, drängten ja geradezu auf die richtige Erkenntnis hin. 1 Ich 
habe mich schon Zeitschr. f. vom. Phil, xv, 122 über die Abneigung 
gewundert welche bei den Sprachforschern gegen die natürlichste 
Herleitung von Vogelnamen, insbesondere für ,Rabe' und , Krähe' 
besteht. Seither ist J. Wintelers treffliche Schrift ,Naturlaute und 
Sprache' erschienen; aber seine Ausführungen haben nicht sehr ge- 
wirkt, sie werden selbst von Kluge unter Kolkrabe, Krähe, Rabe, 
Wiedehopf u. s. w. schweigend abgelehnt. 

S. 401 vergleicht M. zu magy. kenyer ,Brot' eine Menge kau- 
kasischer Formen, und zwar aus der kharthwelischen Gruppe drei, 
die gewiss miteinander nichts zu thun haben. 1. Laf. giari (gjari) 



w i 

fN CO 

O u 






o 2 



F P. 



=> o 

— o 



1 So erweisen sich auch die Bedenken Fr. Müllers, WZKM xi, 205 wegen 

-C £ 

arm. aggaw ,Rabe*, ,Krähe* als unbegründet. 

20* 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



294 Munkacsi Bernät. 

,Brot', wozu die Nebenform diari (djari) und gleichbed. swan. 
diar (Gen. diri) hinzuzufügen sind, sowie mingr. diara , Schmaus^, 1 
da ja auch das laf. giari (die von Erckert gegebenen Formen 
gwjari, gwäri flössen mir einiges Misstrauen ein 2 ) die allgemeinere 
Bed. ,Speise', ,Nahrung' hat. 2. Mingr. laf. swan. k'obali (laf. auch 
koali, kuali) ,Brot'. Nur im Mingr. scheint es der allgemeine Aus- 
druck für ,Brot' zu sein, in den andern Sprachen eine besondere 
Art zu bezeichnen. Im Mingrelischen bedeutet k'obali auch ,Weizen'; 
man könnte hier an eine Uebertragung wie bei russ. xxboz, span. 
pari u. s. w. denken, aber die weitere Verwandtschaft zeigt dass der 
Name dem Getreide ursprünglich zukam. Georg, (wohl veraltet) %or- 
bali, xwarbali bedeutet nur , Weizen ' (bei Staröewskij ist auch 
mingr. xorbali , Weizen') ; es begegnet uns ohne die kharthwelische 
Erweiterung wieder in karat. Icerw, kora, and. kör, kir (hir bei 
Erckert ist wohl Druckfehler), rutul. kir, ferner in kür. %'ül, bud. 
dfchek. %ul, und vielleicht auch in swan. kwet 8 en, tscherk. (abadf.) 
kuct s e, k'ot 8 e y kotj, (schaps.) kuat s e, (kab.) god z , abch. yuad z (Starö.: 
eodc) und in tschetsch. ka. Auch georg. puri hat die Bedeutungen 
,Brot' und , Weizen' (Erckert führt aus der ingil. Md. nur pur für 
, Weizen ' an); die letztere ist wiederum die ursprüngliche, denn an 
der Gleichheit mit gr. Tuupig ,Weizen', lit. purai PL, lett. puri , Winter- 
weizen' lässt sich nicht zweifeln. Vielleicht verhält es sich ähnlich 
mit swan. diar ,Brot' (s. oben), welches nach Staröewskij auch 
, Weizen' bedeutet; ist es etwa zunächst so viel wie , Weizenbrot' (vgl. 
p'atwar ,Hirsenbrot' von p'atw ,Hirse'; tgüwdar ,Käsebrot'), so lässt 
es sich mit georg. laf. dika , Weizen' vereinigen. Man vergleiche auch 
abch. t$a ,Brot' zu t$a (so Erckert) — t$arad z ,Weizen'. Wenn Erckert 
laf. butkudgi als , Weizen' angibt, so hat er bei Staröewskij wuieuu%a 
mit dem darüber stehenden uuejia ,Biene' verwechselt; er verzeichnet 
dika als laf- Wort für , Roggen', Adjarian übersetzt es mit ,ble'. 



t! öi 



w I 

fN CO 

, O) 

O u 



O o 

c v> 
o E 



(T3 



2 5 



F ö. 



u 



CT 



Auch bei Töubinow finde ich dika (diqa) für ,Bartweizen' (triticum 



> <u 



durum) und für , Roggen', sowie für ein paar ganz andere Pflanzen. 

c e> 

1 Vgl. georg*. puri ,B r °t' und (alt) ,Schmaus c . 



2 Vgl. laf. giöri) Icueri ,Mehl c . 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



ÄRJA BS KAUKÄZUSI ELEMEK A FINN-MAGYAR NYELVEKBEN. 295 

Ein vierter georgischer Ausdruck für ,Weizen' scheint doch erst 

der Brotbereitung entnommen zu sein, nämlich ipk'li, falls es 

dasselbe ist wie p'fcwili (Erckert hat auch k'p'ili), mingr. Ictoiri 

,Mehl'. 3. Mingr. ot$komali ,Speise', t/komua, laf. ot/kumu (karat. 

kamat'la) , essen'. M. teilt ab ot£-komali und gelangt so zu einem 

mingr. komali; es ist abzuteilen o-t£komali, und das entspricht dem 

georg. sa-t/meli in Laut und Begriff, wie t£komua ,essen', t£kumuns§ 

,er isst' = georg. t/ama, st-ams (das also nicht von arm. dgamb ,Speise' 

herkommt); aus Tsagareli 31. !). n, 28. 66 entnehme ich noch zwei 
i^ 

Beispiele von mingr. t§k = georg. t£ : t£kidi — mt£adi ,Maisbrot' 

(awar. t$ed, t$ad-, lak. t$'at% abch. t^a ,Brot'), t£kirili = (da-)t£rili 
,verwundet'. Man vergleiche hierzu mingr. t$k r = georg. t§ in t s k r i- 
neli = t§enili ,gezeigt', tjc'imi = t s emi ,mein' (ebd. S. 63). In allen 
diesen Fällen wird k } Je ursprünglich sein; aber in Bezug auf die 
in denen georg. S einem mingr. sie oder sk r entspricht, bin ich zweifel- 
haft. Hier scheint nämlich immer ein w oder u vor Vokal zu folgen 
oder gefolgt zu sein, sodass man an die Einschaltung eines Verbin- 
dupgslautes, wie es z. B. das k zwischen s und l im Romanischen ist, 
denken dürfte; so sk'widi (laf. auch skil) = Swidi .sieben', sk'a (für 
*sk'wa) — sua ,Mitte', usk'uri (swan. wisgw) = wasli , Apfel', sk'weri 
= sweli , Gemse', sk'uami = miwenieri , schön' u. a. (ebd. S. 31); 
möglicherweise verhält es sich mit mingr. d z gw = georg. d*w ähnlich: 
mord z gwi = mard^wena ,recht' (: ,link') (ebd. S. 29). Mit einem für 
das Kharthwelische (das Swanische ausgenommen) anzusetzenden 
*t£kam (mingr. o für a ist sehr häufig) Hessen sich von Verben die 
, essen' bedeuten, vereinigen: einerseits tscherk. (kab.) s%e-n, ander- 
seits die schon von M. angeführten karat. kam-aVla. artsch. kummu-s 
(das Verhältnis zum Präs. k[w]an-, Prät. kunn- bei Erckert ii, 56 
ist nicht klar; i, 182 gibt er artsch. kuen ,essen'), lak. kan-an, awar. 
koan-aze, wozu noch and. kim-iv (Starö.) und chinal. kan-daval hin- 
zuzufügen wären, während andere Formen wie ukki u. s. w. vorder- 



w i 

fN CO 

f\l ^ 

, O) 

o y 

o o 

c v> 

o E 



(T3 



2 5 



_N 
'-I-J 
'Ol 

> <u 

hand ganz bei Seite zu lassen sind. 

ru 



=) O 

— O 

Nicht selten ist M. durch Erckerts unrichtige oder ungenaue 
Angabe irregeleitet worden. So wenn er S. 302 georg. karawi ,Zelt' 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



296 Munkacsi BernAt. 

für eine Umstellung von kawari ,Dach' hält ; dies Wort gibt es gar 
nicht, aber qawari bedeutet ,SchindeK Warum Erckert unter ,Dach< 
nicht bani setzt, sondern banis kawari [^Dachschindel'], weiss ich 
nicht; M. hat dann, durch die Zeilentrennung verführt, das letzte 
Wort für sich genommen (so auch S. 487, wo er georg. unagris 
^Steigbügel' hat; bei Erckert steht unagris awZanda, und das zweite 
Wort allein bedeutet schon , Steigbügel', unagris: ,des Sattels'). M. 
stellt S. 324 magy. hdm ^Pferdegeschirr' zu awar. h!ama ,Packsattel'. 
Er hätte das was er Nyelvt. Közlem. xvn, 95 f. über die Herkunft des 
magyarischen Wortes bemerkt hatte, nicht fallen zu lassen gebraucht. 
Im Awarischen bedeutet h'ama ,Esel' (Gen. h'amil) und h'amil kir 
,Esellast'. Daraus hat Erckert, der awar. xhama = h'ama ,Esel' 
sehr wohl kennt (S. 59) unter ,Packsattel* gemacht: y xKama } hiß 
(S. 110). Erckert bietet ein georg. ywat§it§a ,Prosch' dar; ich finde ein 
solches oder auch nur ein ähnliches Wort sonst nicht — sollte es 
aus russ. nßanymna verderbt sein? Jedenfalls wird man im ersten 
Teil nicht mit M. S. 311 abch. kua , Schildkröte' zu suchen haben, 1 
sondern das Froschgequack. In andern Fällen hat die falsche An- 
führung nach Erckert keine weiteren Folgen, wie georg. t'zoli für 
t'oli? ,Auge' (S. 122), kat § für kat 8 i ,Mann' (S. 356) u. s. w. 

Auf die Erklärung magyarischer Wörter aus den kaukasischen 
Sprachen gehe ich nicht ein. Manche sind geradezu überraschend, 
z. B. baglinca, pdkelenc, pakelencs, paklincs ,kleine Fliege', ,Wanze', 
,Schafzecke' = georg. baylind^a (so, nicht mit Erckert baglind^o) 
, Wanze' (S. 148). Hingegen ist es mir sehr wenig wahrscheinlich 
dass zwischen magy. legy , Fliege' und den kaukasischen Wörtern 
dafür wie t'ent'a, t'ut\ t 5 amt ä u u. s. w. irgend welche Verwandtschaft 
besteht (S. 439). Die letzteren haben offenbar ihren Ursprung in 
der Lautnachahmung, wie der Name der Tsetsefliege, und sind eben 

° N 

deswegen so verbreitet; auch die Uebereinstimmung zwischen den 



Q. O) 



T3 



03 






(T3 



> 

F p. 



— 

1 Uebrigens glaube ich gar nicht dass kua auf abchafisch ,Schildkröte* be- 
deutet. Starcjswskij gibt in diesem Sinne: KyötipHWis, aber unmittelbar über qepe- 



naxa steht bei ihm ^epßL, und daneben axya\ Erckerts Auge wird sich wieder 
einmal verirrt und axya für ,Schildkröte f genommen haben, nur dass er akua schreibt. 



.E -o 

T3 £ 

E-e 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 






Arja es kaukäzüsi elembk a finn-magyar nyelvekben. 297 

Wörtern für ,Floh' im ganzen kaukasischen Gebiet (tjit, tgika, 
tsqil u. s. w.; vgl. georg. tkipi, arm. tiz, engl, tick u. s. w. ,Zecke') 
erklärt sich aus Lautsymbolik. Im magy. legy würde die ausdrucks- 
volle Wiederholung des Silbenanlauts ganz verloren gegangen sein. 
Hie und da Hesse sich für den Fall dass überhaupt das magyarische 
Wort aus einer kaukasischen Sprache stammt, noch eine passendere 
als die von M. angeführte Form beibringen, so für magy. csilla 
,Meerzwiebel', ,Rietgras' neben t§ala , Rietgras' noch tiili ,Rohrkolben', 
,Igelskopf, , Knopf binse', , Gliederbinse' u. a. 

H. SCHUCHARDT. 



w I 

fN CO 

r\l ^ 

, 0> 

^ u 
O o 

■ 

^-^ 4-1 

TD ±3 

- "r? 

£ ö. 

P 

U 

O <L> 

*S 

■h! ■— 
'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

to _c 
in +j 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



Kleine Mittheilungen. 



Die ,Bhartrhari'- Strophen des Pancatantra. — Die unmittelbare 
Veranlassung zu der gegenwärtigen Notiz ist das Eintreffen der fol- 
genden, mir bisher unbekannten Ausgabe der drei Satakäni: ,The 
Nitisataka Sringärasataka and Vairägyasataka of Bhartrihari. 
Edited with Hindi and English Translation, copious critical and ex- 
planatory Notes, parallel Thoughts from numerous authors &c. &c. 
&c. by Purohit Gopi Nath, M. A., Vakil, Jeypore Durbar. Printed 
By [so!] Khemraj Shrikrishnadass Shri Venkateshwar Press Bom- 
bay. 1896/ 

Diese Ausgabe bietet in ihren Anmerkungen manches Gute an 
sachlichen Bemerkungen und Nachweisungen von Parallelstellen. Sie 
ist die Erstlingsleistung eines ,amateur editor', wie sich S. 54 der 
Verfasser selbst nennt. Kritisch ist der Text bedeutungslos, weil 

o u 

er auf keinerlei handschriftlichem Material beruht. 

In der ,Preface* wird der Nachweis versucht, dass Bhartrhari, 
den der Verfasser für den Autor der drei öatakäni hält/ um 50 oder 
60 nach Chr. gelebt habe. Dieser Nachweis fusst zum Teil auf den 

8 | 

- "r? 

F P. 



■o 






w i 

fN CO 



o o 

c v> 
o E 



(T3 



u 



1 S. 38 wird sogar behauptet: ,1t is therefore proved beyond controversy, tbat 

Bh. is the author of these Satakas.' Ich kann hier den ganzen Beweis nicht prüfen, 

der zum Teil auf der Tradition, zum Teil auf 'Bhartrhari-nirveda-nätäkam by Hari- 

haropädhyäya , und 'Bhartrihari's Streets (so!) Plays or Melodramas' beruht. lieber- 
en öi 

zeugen wird der Verfasser damit kaum einen Europäer. Sagt er doch selbst S. 23: 

'European scholars will no doubt laugh that I make much of these trifling plays. 

But I would beg permission to remark that the fact of their having survived so 

long must be a sufficiant guarantee of their being founded on authenticated hi- 

storic and real life. A lie cannot last long.* 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Kleine Mittheilungen. 299 

im Pancatantra enthaltenen Strophen des ,Bhartrhari'. Der Verfasser 
sagt nirgends, was er unter ,Paiicatantra' versteht. Aus seinen Zi- 
taten ist aber ersichtlich, dass er Kielhorn-Bühlers Ausgabe meint. 
Von den verschiedenen Recensionen des Werkes weiss er nichts; 
auch ist ihm unbekannt, dass bei Somadeva eine Pancatantrafassung 
vorliegt, trotzdem er auf S. 30 als Parallele zu der von mir in dieser 
Zeitschrift Bd. xvi, p. 202 ff. behandelten Strophe ^tf (so!) ^n^TOT- 
qifa*ifV«l die von mir ebenda herbeigezogene Stelle aus Somadevas 
Werk giebt (er zitiert: W*refttMIJi\ Trfl^rcffansfä 8 cTTlJO- Was 
auf diese Ausgabe dennoch unsere Aufmerksamkeit zieht, ist die 
Tabelle S. 25 ff., welche den Nachweis von ,Bhartj'hari-Strophen' in 
einer grossen Anzahl (43) anderer Werke enthält, die nach des Ver- 
fassers Ansicht aus den Satakäni geschöpft haben. 

Auf S. 28 unter N. 21 werden 21 Strophen (15 aus dem Nlti- 
sataka, 5 aus dem Srrigärasataka und 1 aus dem Vairägyasataka) 
als im Pancatantra enthalten bezeichnet. 

Nun hat Weber bereits 1 15 Strophen aus den drei Satakäni in 
Kosegartens Pancatantra-Text nachgewiesen. Da wir jetzt über die 
Textgeschichte des Pancatantra einigermassen unterrichtet sind und 
namentlich durch Somadeva, die Ausflüsse der PahlavI-Uebersetzung, 
den ziemlich genau datierten Text Pürnabhadras und die termini a 
quo und ad quem des sogenannten textus simplicior sichere chrono- 
logische Anhaltspunkte haben, so ist es vielleicht interessant, die von 
Weber und Purohit Gopi Nath angeführten Strophen bezüglich ihres 
Vorkommens in den Pancatantra-Texten zu prüfen und durch unser 
eigenes Material zu vervollständigen. Am einfachsten wird ihr Vor- 



T3 



ö. 2> 



w i 

fN CO 

O u 



o o 

c v> 
o E 



> 

2 I 



> des Pancatantra; 



kommen durch die folgenden Tabellen erläutert. In diesen bezeichnet: 
Kos. Kosegartens Text 
K-B. Kielhorn-Bühlers Ausgabe 

H. die von Kosegarten so bezeichnete Hamburger Hand- 
schrift (+ bedeutet, dass die Strophe an entsprechen- 
der Stelle in H: verhanden ist); 
Schm. Schmidts Uebersetzung des ,Textus ornatior'; 



F P. 



u 



1 Variae Lectiones p. 13. 



2 T5 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



300 



Kleine Mittheilungen. 



Som. Somadeva; 
SP. das südliche Pancatantra (nach Haberlandts Ausgabe); 
Syr. die alte syrische Uebersetzung (Bickells deutschen 

Text); 
Hit. Hitopadeäa (Petersons Ausgabe; nur dann zitiert, wenn 
die betreffenden Strophen noch in einem Pancatantra- 
Text belegt sind); 

(von Bohlens Ausgabe). 



N«. 


Nitisataka 


r 

Svng. 


Si'ögäraäataka 


Vair. 


Vairägyasataka 



Die erste Tabelle giebt die von Weber bezeichneten Strophen. 
Ein * vor dem Anfang bedeutet, dass die betreffende Strophe auch 
bei P. Gopi Nath aufgeführt ist. Die zweite Tabelle giebt die nur 
von Gopi Nath aufgeführten Strophen. 



■o 



ö. _! 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



u 

O <L> 

*S 

■h! ■— 

'i/i öi 

> <U 

C CT 

=) O 

— o 

c O 

.E -ö 

-ö £ 

E-e 

E => 

fD O) 

■o E 

(U o 

1o Q 

£ _! 

ü Q_ 






Kos. K-B. H Schm. Som. SP. Syr. Hit. Nlt. Syng. Vair. 

i,151 i,135 + i, 123 — - — — - 81 — 

_ - — — 82 — 



i,202 i,188 cd + i, 162 

+ 203a + 189ab + 

^hftf^rf^r TT^rf^r 1,210 — — — 
*~~ni: ^irtstht i, 204 

**l<1HHT% 1, 280 



**rar~pn ~ 1, 473 

w^npPf^tWT 11, 38 

WTW ^T^° 11, 88 

*^T*f hWT "HT^ 11, 159 



1,191 
1,250 
i,425 






11, 151 
in, 193 f. iv, 77 
in, 195 iv, 78 
in, 255 in, 177 
iv, 34 a iv, 32 a + iv, 29 a 
iv, 36 iv, 34 4- iv, 30 



— i, 163 — — — — — 
+ - - - - - 57 
+ i, 448 — i, 158 — n, 166 39 
_ _ — _ — - 50 

— ii, 160 — — — — 82 
-(- — — — — _ 35 
+ in, 177 — — — — — 
-+- in, 178 — — — — — 
-}- — _____ 73 



21 — 

76 — 



— 75 

— 74 



75a — 

64 — 



v, 21 v, 23 + Hs. K — — — S _ C * L ??* — - 109 B 



.oo 



gle 



i, 144 



Original frann 
CORNELL UNIVERSITY 



Kleine Mittheilungen. 301 

II. 

Kos. K-B. H Schm. Som. SP. Syr. Hit. Nit. Srn?- Vair. 

^fT^fiff^ ^f^riT i,33 i, 27 + i, 17 l — — — — 24 — — 

^^Nsrrenjfinc; i, 185 i, 169 + i, uc — — — — 34 — 

WftayuqfWT i,224 — — i,220 — — — — Webers A 20— — 
*T^prj*JifRfM ii, 20 ii, 19 + ir, 15 — ii, 5 — i, 38 87 — — 

^T^ftf^S^TPST — v, 26 + ii, 81 — ii, 35 — i, 97 Suppl. 5 — — 

00 

o 

r-. 

P. Gopi Nath bezeichnet ausser diesen und den vom Unter- 
zeichneten WZKM. Bd. xvi, p. 202 behandelten Strophen noch die fol- 
genden als im Pancatantra enthalten: 

Pag. 41, N. 41 q^Mf« ftrt . . 'The 6loka is also found in the Pan- 
chatantra (m^o^Q/ 

Pag. 53, N. 53 «^T *rfT?<Nft; der Hinweis auf das Pafic. befindet 
sich nicht unter dem Texte, sondern nur in der Liste 
S. 28. 

Pag. 57, N. 57 *T ^rf^W^^faT^T^ 'Quoted . . . under the Pancha- 
tantra (<H?H) in the Subhäshitävali (^frf^RTTTfW I 
WQft). The stanza is found in the Panchatantra.' 

Pag. 63, N. 63 f^Plffr 4W**, aufgeführt Liste S. 28. 

Leider fügt der Verfasser nicht bei, in welchem Pancatantra- 
Texte er diese Strophen gefunden hat. In den mir zugänglichen 
gedruckten wie handschriftlichen Fassungen sind sie jedenfalls nicht 
enthalten. Immerhin ist es bemerkenswert, dass die Strophe 53 
$<*•!• ^f^CWn^t sich — wie Gopi Nath nachweist — bei Somadeva 
(,*qwK<MI*i\ ^fa^MÄ^Wt 3 *', d. i. lxiii, 154) findet, und zwar 
in der Form ^% ©<*mi^ ^ ffcft fa^TOff: *F$W V . Dies ist allerdings 
wohl unsere Strophe, und bemerkenswert ist, dass sie bei Soma- 
deva unmittelbar hinter dem Schluss des 4. Buches des Panca- 
tantra auftritt, das mit 61. 153 endet. Sollte der Verfasser also in 






w I 

fN CO 

f\l ^ 

, O) 

o u 



o o 

c v> 
o E 



fö 



2 5 



F P- 



u 

O <L> 

N 



ro 

5 S 



ro 



rö 



1 Nur in K und einem Nachtrag am Rande von A. 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



302 Kleine Mittheilungen. 

der That hier stillschweigend nach einer uns unbekannten Fassung 
des Pancatantra zitieren? 

Diese Vermutung erhält eine Stütze durch den Umstand, dass 
Gopi Nath seine Strophe JSfitis. 106 (Bohlen 75) ^ftfrT^lTfa als im Paii- 
catantra vorkommend bezeichnet (wieder ohne irgend welche nähere 
Angabe). Diese Strophe findet sich weder im ? textus simplicior^ 
noch bei Schmidt und in den vier Hss. des Ornatior, die ich ein- 
gesehen habe (darunter die beiden ältesten aus dem Deccan College), 
dagegen aber bei Kosegarten, t. orn. i ; 62, SP i, 30 (Hit. n, 61) und 
in der alten syr. Uebersetzung p. 6, 17. Die Sanskrit-Strophe lautet: 

*5fvfrTOTfc ff Wphf H^T W^pir: WRTfH I 

TOtgiaranft iftto ^jprfa: fwr vi fit ^Tf^rf^ n 

Syr.: , Sehet da einen Strebsamen, der, wie sehr er auch 
in Geringschätzung und Dürftigkeit gerathen ist, doch nie sein 
Geschlecht und seine Art verleugnen kann, gleich einem bren- 
nenden Holze, welches, wie sehr man auch seine Spitze nach unten 
wendet, doch nicht umhin kann seinen Glanz aufwärts strahlen zu 
lassen/ 

Ausser dieser einen Strophe finden sich alle dem ^Pancatantra' 
und jBhartrhari' gemeinsamen Strophen erst in späteren Texten. Die 
eben besprochene, in der syr. Uebersetzung enthaltene Strophe da- 
gegen bestätigt mein in dieser Zeitschrift S. xvi, 205 unter 3 gefun- 
denes Resultat, denn sie findet sich in allen Hss. v. Bohlens und 
Webers, gehört also zum Grundstock des Nitisataka. 

Die beiden Strophen des Vairägyasataka, v. Bohlen 74 und 75, 
sind wohl sicher gleichfalls dem Pancatantra entlehnt. Die Ed. Srir. 
hat sie als 71 und 70, Rog. als 72 und 71, v. Bohlens Hs. A als 71 
und 70. Dagegen fehlt in v. Bohlens Hs. B die erste, und in 
Webers Hs. B fehlen beide. Sie sind also wohl erst spät in den 



CÜ 



ti öi 



w i 

fN «/) 

f\l ^ 

, CD 

^ U 

O o 

c v> 

o E 



CD 



F p. 



u 
o <d 

■4-J ±1 

Text des Vairägyasataka gekommen und gestatten keinen Schluss 



auf die Komposition dieses Buches. 



<D , 

> CD 

C CT 

=) O 

— o 

Ausser den oben angeführten Strophen enthält eine hs. Liste 
Herrn Prof, Leumanns, die mir vorliegt, noch diese Nachweise: 

£ -o 
-ö v 

E-e 

E => 

CD CD 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

CD ^ 

C _Q 

CD 3 

ü Q_ 



Original from 



Kleine Mittheilungen. 



303 



fehlen in allen anderen Fassungen des 
Pancatantra. 



Nit. 41 = SP. n, 87. 
„ 51 = „ ii, 78. > 
„ 64= „ 1,44.. 

Ich selbst habe alle in von Bohlens Ausgabe und bei Schiefner- 
Weber, Varr. Lectiones vorkommenden Strophen mit meinem eigenen 
alphabetischen Verzeichnis sämtlicher Pancatantra-Strophen verglichen 
und kann auf Grund desselben noch folgende Nachlese bieten: 



0} 






Cl 



rN ^ 



F P. 



u 

O CL) 



<U 



=> O 

— o 



w 



£ oJ 

_^ 03 

£ -o 
-ö £ 

E-e 

E => 

fD O) 



(U o 

ü Q_ 



Kos. K-B. H Schm. Som. SP. Syr. Hit Nit. Sniff. Vair. 

*ftmM<«nH i,9i _--- u _ 

^ (Kos. orn. r, 71) 

^If^T^fq ^»: W^ i,458 t,408 + i,398 — — 28,14 — Schiefner p. 12, 1. 14 

*TR*J3f *t tot 



— — — ir, 83. 84 — — 

— — — n,88 - - 

— — — ir,90 — — 

— — — ii, 152 — — 
v, 14 1 v, 15 1 + v , ll 1 — — 

— v, 38 — nur Hs. K. — — 



— — B29ab — — 

(Weber p. 23) 
41,44 — Schiefner p. 7, 1.11 v.u. 

— — 56 — — 



— — — 90 l 

i, 35 Schiefner, p. G, 1. 14 
GaL Nitis. 35 



Ich habe diese Parallelstellen nur der Vollständigkeit wegen 
gegeben. Keine einzige von ihnen gestattet einen Schluss auf Bhartr- 
haris Autorschaft der Satakäni. Einen solchen Schluss gestattet da- 
gegen die Strophe Srng. 69 ed. Bohlen, die in allen Ausgaben und 
Hss. steht, also dem Grundstock des Werkchens angehört. Sie for- 
dert auf, nicht draussen nach Reichtum zu jagen, sondern nach 
Hause zu gehen und die jungen Gattinnen zu gemessen, so lange 
das Alter ihre Anmut noch nicht zerstört hat. Diese Strophe beginnt 
mit dem Vokativ Tl^HT. Das ist sehr seltsam; denn ein draussen 
nach Schätzen jagender König kann nur in irgend einem ganz be- 
sonderen Zusammenhange gedacht werden. Keinesfalls ist er typisch. 
Typisch ist in solchem Falle in der indischen Lyrik der Kaufmann. 



1 Zwei verschiedene Recerisior.en derselben Strophe. 



rOO 



gle 



Original from 
CORNELL UNIVERSITV 



304 Kleine Mittheilungen. 

Aus dieser einfachen Betrachtung aber ergiebt sich, dass unsere 
Strophe aus dem Zusammenhange gerissen, also einem anderen 
Werke entlehnt ist. 

Döbeln, April 1902. Johannes Hertel. 

Armen, -k r als Pluralzeichen. — Die von Brugmann, Grundr. 1 11, 
660 § 313 angedeutete Gleichheit des arm. -k' im Nom. PI., im Instr. 
PI., in der 1. P. PI. und in der 2. P. PI. kann nur dann bestehen 
wenn es ein reines Pluralzeichen ist, das an eine Singularform an- 
tritt. Als solches zeigt es sich in drei Fällen unmittelbar: 

mard ,der Mensch' mard-Jc ,die Menschen' 

mard-ow ,durch den M.' mard-ow-h' ,durch die M.' 
gere-m ,ich nehme' gere-m-k* ,wir nehmen.' 

Zu gere-s ,du nimmst' stellt sich allerdings gere-k f ,ihr nehmt' 
nicht in entsprechender Weise, oder wäre es möglich gere-k* aus 
gere-s + -k r zu erklären? Dürfte man auf ein *gere-si zurückgehen? 
Sonst würde Angleichung der 2. P. an die 1. P. anzunehmen sein. 
In andern Zeiten bereitet auch die 1. P. Schwierigkeit: han-a-k K an- 
zogen': han-i ,ich zog' (han-i-k\ han-e-k' ,ihr zogt': han-e-r ,du 
zogst'). Eine solche Ableitung des verbalen Plurals vom Singular 
herrscht im Kharthwelischen, z. B. : 

georg. w-a-bam ,ich binde' swan. %-w-a-bem 
a-bam ,du bindest' fja-bem 

w-a-bam-t r ,wir binden' %-w-a-bem-d 

a-bam-t* ,ihr bindet' y^a-bem-d. 

Wir begegnen nun im Kharthwelischen ein dem arm. -k K auch 
äusserlich entsprechendes Pluralzeichen, nämlich -q, -qe, -#, welches 
aber nur der 2. und 3. P. dient, im Georgischen nur dem dativischen 
Objekt, im Swanischen auch dem Subjekt, z. B. ingil. mo-g-tsa-q ,er 
gab euch', altgeorg. h-k*on-da-qe ,er war ihnen', swan. %~a-bem-% ,sie 






w I 

fN CO 

f\l ^ 

, O) 

° m 



o E 



(T3 



2 5 



> <u 

binden', a~t r -be-x ,sie banden*. Näher habe ich dies besprochen 

ro 



=) o 

— o 

Ueber den passiven Charakter des Transitivs in den kaukasischen 



Sprachen S. 41 u. s. w. und Melanges Ch. de Harlez S. 278 — 280. 

E-e 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 
T3 



Ö. ^ 



<=> o 



F P. 



u 



CT 



Kleine Mittheilungen. 305 

Wie in den Lauten, so mag das Armenische auch in den Formen 
vom Kharthwelischen beeinflusst worden sein, in den äusseren wie 
in den inneren ; was diese anlangt, so erinnert das armenische Ver- 
hältniss zwischen Nominativ und Akkusativ, sowie das zwischen Ge- 
netiv und Dativ sehr an das Kharthwelische, und von der allgemein 
kaukasischen Passivität des Transitivs scheinen sich auch im Ar- 
menischen Spuren vorzufinden. In umgekehrtem Sinne hat sich ja 
ebenfalls manche Wirkung vollzogen. In meiner Schrift lieber das 
Georgische S. 14 machte ich auf einen bisher nicht erwähnten geor- 
gischen Kasus aufmerksam, eine Art Instrumental auf -iw, der sich 
nur von gewissen Wörtern erhalten hat. Ich habe seither erkannt 
dass dieses -iw die Endung des arm. Instrumentals von i-Stärnmen 
ist; man vergleiche z. B. georg. syica-pW-iw = arm. tarber kerp-iio 
,auf andere Weise'. 

H. SCHUCHARDT. 



luf^iup und y>\. — Gehört armenisch tufriup ? dry cow's düng' 
etymologisch nicht zu «y/»*/. ,verbrennen' und neupersisch jM ,Feuer'? 
Denselben Bedeutungswandel, der auf die vom Feuer und vom 
Dünger ausgehende , Wärme' als Tertium comparationis zurückführt, 
beobachten wir in arabisch j^> ,Kameel-, Schafmist' (davon ^^i >Ka- 
meele, das mistende Vieh v.ocz i^oyr?*', neben hebr. Tjpa und syr. |f^=> 
? Vieh' überhaupt) und in hebr. ^yn /verbrennen*. 



Arabisch ^^. — Die Wurzel heisst nicht bloss , verlassen, lassen', 
sondern auch ,legen' vgl. Dozy s. v. Analogien bieten neup. ^^l 3^ 



und türk. &>$*. 



In der semitischen Wurzel kr' (mp )^o \y>) finden wir die Be- 
deutungen ,rufen, nennen, lesen', ebenso nebeneinander, wie im neu- 



pers. o^^; i m armen, fa^uM^ (classisch armenisch ,lesen' wohl = 
£üß-brn%nt.^ und im osman. i5*°y>y. 



c (5 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



30(5 Kleine Mittiieilungen. 

Einige vorläufige Berichtigungen zu Hermann Vämbery, Alt- 
osmanische Sprachstudien, Leiden 1901. 

Zu S. 11. Neupers. <W* ,all' ist und bleibt persisch und geht 
nicht auf altosmanisches qamu zurück. S. Horn ; Neupersische Ety- 
mologie. 

S. 141. ? Niesen< heisst auf osmanisch i£*r^ un( l nicht ansirmaq. 

S. 185. ?L5 » qaj (itmek) sich erbrechen' — <J> ist doch arabisch! 

S. 103. jZjjs* korüker ? blind und taub' ist doch nichts anderes 
als neupers. ^ ? blind'+^ 7 und' +jS ; tauV! 

S. 196. 7 ^^y° mezlcit Moschee, von arabisch meszid, eine Tiirki- 

sicrung dieses Wortes, die heute ganz unbekannt ist.' — Das Arme- 
en 

nische hat das Wort in der Form Jfäfip- mzlcit. V. Bedrossian s. v. 

6 

S. 211. jU^L ? Rolle. Papierrolle, Brief ist von neuosman. tomar 
,langcr Stock mit rundem Kopfe' wohl zu trennen ! Ersteres ist doch 

Maximilian Bittner. 



ö. 2> 



Cl 



O o 



F P. 



u 

O CL) 

*S 

■h! ■— 
'i/i öi 

> <U 
C CT 
=) O 

— o 

c O 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 



Original frorn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Bemerkungen zur arabischen Trauerpoesie/ 

Von 

I. Goldziher. 

L 

Gleichwie sich aus der alten Käfija das Hi£ä 3 -Ge dicht heraus- 
gebildet hat, sind auch die rhythmischen Sag'-Sprüche, in denen bei 
den alten Arabern die Todtenklage (nijäha) zum Ausdruck kam, 
gleichsam die primitiven Keime des Entwicklungsproductes, das im 
System der poetischen Litteratur der Araber als Martija seine 
Stelle hat. 2 Die alte Nijäha trägt noch nicht den Charakter poe- 
tischer Bethätigung. Sie wird nicht durch Dichter besorgt, sondern 
ist erst lediglich die Uebung einer religiösen Pflicht (luctus religio), 
die zunächst im Kreise der Angehörigen des Verstorbenen ausgeführt 
wird. 3 Der Verstorbene hat ein Anrecht auf diese Leistung der 
Ueberlebenden, sowie auf alle anderen Bräuche der Bestattung; 4 ihre 
Unterlassung ist, gleichwie die der Blutrache, die Verletzung einer 
Pflicht, die man dem Todten schuldet. Ihn ohne Todtenklage der 



t! öi 



w I 

fN «/) 

f\l ^ 

, O) 

^ U 

O o 

c v> 

o 2 



(T3 



§ S 



Erde überlassen galt als beleidigend und entehrend. 5 Wir besitzen 



F P. 



u 






03 



fD 



1 Der vi. Section des xui. internationalen Orientalistencongresses vorgelegt, 
4. Sept. 1902. 

2 Wellhausen, Heidenthum 160, Abhandlungen zur arab. Phil, i 76 f. 

3 Jacob, Beduinenleben 140. Die Frau hält den nawah Lg. ^ ^Vs. in der 

interessanten Stelle Ag. xx 100, 19. 
^" o 

4 Von der richtigen Erfüllung dieser Bräuche benutzte man den Ausdruck 



JLol, s. die Note Nöldekes zu Delectus vet. carmin. arab. 51, 7. 



5 c Ant. 7, 19; Hud. 158, 3 ^^U J^ ^ ^AÜ^ji. Vgl. Muh. Stud. i 260. 

Wiener Zeitschrift f. d. Kunde d. Morgenl. XYI. Bd. 21 

o "c 

E => 

in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



308 Ignaz Goldziher. 

ein Beispiel dafür, dass zwei Freunde (Durejd b. al-§imma und 
Mu c äwija b. 'Amr von den B. Sarid) ein eidliches Biindniss darauf 
schlössen (U^y^ ^J^ 3 )? dass der Ueberlebende dem anderen die 
Ehre der Todtenklage erweisen werde und dies Biindniss wird in 
eine Reihe gestellt, mit der Pflicht der Blutrache, welche dieselben 
Freunde für einander übernahmen. 1 Durch das Institut des IJilf 
werden also in diesem Falle specielle Attribute der Blutsverwandt- 
schaft auf Stammfremde übertragen. 

Sehr früh nimmt die Todtenklage auch entwickeltere poetische 

o 

Formen an. Man nimmt für die Nijäha die Mitwirkung der Dichter 
in Anspruch. 2 Aus den Sag c -Rufen werden zunächst kurze metrische 
Sprüche von wenigen Zeilen, 3 zuweilen auch längere Regez-Lieder, 4 
aus denen sich dann stufenweise die ausgebildete Martija in der 
metrischen Mannigfaltigkeit und Kunstform der Iyasiden-Gedichte 
entwickelt. Dasselbe gilt auch vom musikalischen Element der 
Todtenklage. Die einfachen volkstümlichen Melodien der Klage- 
frauen werden durch Gesangs kün stier zum Trauergesang entwickelt, 






03 



<=> o 



(T3 



2 5 



F P- 



<u 



TD 



O) ¥? 



Die Unterlassung der Todtenklage gilt als Beweis dafür, dass der Verstorbene ein 
^JÜ war. In einem Verse der Banü Hiläl-Episode Kissat al-barzacha 8, 15: 

Bei den Römern war die Entziehung der Todtenklage die Folge der schwersten 
Criminalstrafen; Mommsen, Römisches Strafrecht 989, Anm. 8. 

1 Ag. ix 14 oben. 

2 In der modernen Todtenklage in Syrien, deren Wesen uns zuerst durch die 
Mittheilungen Wetzsteins bekannt geworden ist, werden von den Kawwäla- Frauen 
metrische und gereimte Dichtungen, die sie für solche Anlässe in Vorrath haben, 
vorgetragen. Zeitschr. für Ethnologie v 297. Neuerdings haben wir sehr interessante 
volksthümliche Todtenklagentexte erhalten von Dalman, Palästinischer Diwan 
(Leipzig 1901) 316 ff.; und Enno Littmann (des letzteren Werk ist bei Drucklegung 
gegenwärtiger Abhandlung noch unter der Presse). Der vortreffliche ägyptische 



u 

Gelehrte Ahmed Zek! hat in einem beim Orientalistencongress in London (1892) ge- 
haltenen, in seinem Reisewerke (Al-sefer ilä-1-mu'tamar. 2. Aufl., Büläk 1894) 475 ff. 



gedruckten Vortrage die Veröffentlichung einer Sammlung moderner Todtenklagen 



in Aussicht gestellt; er hat jedoch dies Vorhaben bisher nicht ausgeführt 



8 z. B. Hud. (Wellhausen) p. 47, 19, Usd al-gäba iv 172. 
4 z. B. Lebid (Huber-Brockelmann) Fragm. nr. 12. 14. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Bemerkungen zur arabischen Trauerpoesie. 309 

den sie bei Trauerversammlungen (ma'ätim) vortragen/ wobei sie 
von der Gesellschaft durch einen Vorhang getrennt sind. 2 

Durch das Vorhandensein dieser höheren Entwicklungsformen 
wird jedoch die Uebung der einfachen unmetrischen Sajjf-Klagen 
nicht völlig beseitigt. 3 Diese dienen immerfort — wenn auch nur 
zum Schein — dem unmittelbaren Ausdruck des überwältigenden 
Gefühls und bleiben ein Bedürfniss auch neben dem Trauergedichte, 
das ja in der Regel Product der, Ueberlegung und künstlerischen 
Arbeit ist und darum die Stelle der primitiven Todtenklage nicht 
ebenbürtig vertreten kann. Der Unterschied zwischen \nj und nrp 
bietet sich bei der Betrachtung dieser beiden Arten der Todtenklage 
als Parallele dar. 4 

Aus den in der Litteratur erhaltenen alten Sag -Klagen können 
wir uns eine annähernde Vorstellung vom Charakter der alten Njjäha- 
Rufe der Araber bilden. Wir möchten nur auf einige Proben hin- 
weisen : 

1. Zunächst gewährt der Trauerruf, den die Mutter des 
Ta'abbata sarran, eine Frau von den Banu-1-I£ajn b. Gasr, über 
den Tod ihres Sohnes erhob, eine Vorstellung von der Form der 
alten SagVNijäha. Er ist mitgetheilt im Hudejliten-Diwän ed. Well- 
hausen 47, ganz unten (9 Glieder) 'J-^*H o~t^ * J**^ crt 'S *^ S 
£\ j4*^ V^r^- Beachtenswerth ist dabei die in solchen Trauer- 
rufen und auch in den alten Maräti hervortretende Eigenthümlich- 



w i 

fN CO 

O u 






keit, die negativen Eigenschaften des Betrauerten zu preisen (,du 

. , . " ( . 5 



warst nicht . . /). 

2. Aus heidnischer Zeit ist ferner der Trauerruf des Zuhejr b. 
Gadima über die Ermordung seines Sohnes Sas (Ag. x, 10): ^^ 



(T3 



2 5 



F P. 



1 Der nachmals berühmte Ibn Surejg begann seine musikalische Laufbahn 
als professioneller Klagesänger, Ag. i 99, 18 wo auch einige Daten über den Ein- 
fluss der Gesangskünstler auf die Todtenklage zu finden sind. 

2 Ein wichtiges Beispiel Ag. n 129 (Gari4). 
Vgl. ^yl^Jb j\yÜ\ C^ Ui (mittlere Omajjadenzeit) Ag. vi 27, 19 = 



> <u 

C CT 

B ° 

Pseudo-Gähiz, Mahasin~237, 4. 

4 Siehe Büdde in der ZDPV. vi 184. 

6 Vgl. Abhandl. zur arab. PhiloL i 77, Anm. 4. 

21* 

E => 

$£ 

e m >— » I 

1 1 b Y ^ ,( ,0 Jy e CORNELL UNIVERSITY 



Original fronn 






TD 



Ö. ^ 
V öl 



w I 

fN CO 

, O) 

O u 



f 10 - 
O o 



o 5 



(T3 



F P. 



'01 
> <u 

3 O 



03 



310 Ignaz Goldziher. 

^b {JJ^ ^ <J « ^li Jii; ^ • ^UH U, o-UJ^ c ^-LÄ L.^. Typisch 
ist hier das in Trauerrufen überaus häufig wiederkehrende admirative 
^ (Sure 69, l); 1 die Vorliebe für die Anwendung desselben ist dann 
auch in die Martija-Poesie übergegangen. 2 

3. Trauerruf des 'Abbäs b. c Abd al-Muttalib über seinen Sohn 
Kutam (Ibn Rosteh ed. de Gobje, 201, 3): ^$> *~yybi b '^is b ^L 

4. Nach dem Tode des Propheten klagt Fätima: (B. Magäzi 
no. 85, Ende): 

s[5b/t U*3 jCrf 'aUM b] 

'»US IS, ^U/t <*US\ b 
•^ ... 

5'sbJü Jj^ ^j '*u/t b 

5. Der bei Ibn Hifiäm 699, 2 in erweiterter Form (aber ohne 
Wiederholung des 1. Gliedes) gegebene Trauerruf der Mutter des 
Sa c d b. Mu'äd scheint in ursprünglicherer Fassung in dem Usd al- 
gäba 11, 298 mitgetheilten Text erhalten zu sein: 



Ij^sr^ «^»^ »Jjuü wX9c«o f \ ^^ 

6. Wie uns diese letztere Nijäha bereits den Uebergang der 
unmetrischen Todtenklage zu einem festen metrischen Rhythmus 



veranschaulicht, so tritt uns diese Erscheinung auch in der Todten- 



1 Vgl. Nöldeke, ,Zur Grammatik des classischen Arabisch* 61. 

2 Ag. x 65, 16; xxi 192, 12; Hud. 90, 10; Hud. Wellhausen 47, 16; Sawä'ir 



ed. Bejrüt i 146, 10; Gamhara 133 v. 13 (= Chiz. ad. iv 374, 5 v. u. ^-L\ U ^y^) 
Mucht. 28 ult. Tebr. Ham. 422 ult. (^^Jl J^5 L> ^J-^Jül). In diesem Sinne wird 



auch in einem Fragment von 'Ubajd-Alläh ibn Kajs al-Rukajjät (ed. Rhodokanakis, 



Anhang nr. xvm) die richtige La. sein: £Ii\ Uo 2Ss\. 

8 Dieser Zusatz in der bei Tabaräni und Därimi, al-Mu'gam al-sagir (lith. 
Dehli 1312) 224 überlieferten Version; Kastalläni vi 527 bringt ihn aus diesen ci- 



tirend als letzte Zeile. 

4 Fehlt bei Tabaräni. 



5 Tabaräni *Uj\. 



2 75 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zur arabischen Trauerpoesie. 311 

klage entgegen, die der Chalif Mu'äwija schon bei Lebzeiten 1 von 
seiner Gemahlin Fächita 2 anstimmen lässt: 3 

Im Hezeg-Rhythmus, der neben dem Regez die früheste Dis- 
ciplinirung des Sa£* darstellt, formte sich ganz unbeabsichtigt die 
Sag'-Todtenklage. 4 Das Hezeg ist eine beliebte Form der alten Volks- 
dichtung. Wir kennen auch einige Brautgesänge aus Medina in 

diesem Metrum. 5 

I-» 

00 

o 

r-. 
r-- 

II. 

tN 

Wie bei den oben angeführten Beispielen bereits angedeutet 

o 

wurde, bewahrt die Trauer-Kaside auch in ihrer entwickelten 
Ausbildung manche formale und materielle Eigenthümlichkeit der 
Urformen, aus denen sie herausgewachsen ist: der Sag -Rufe. 

Am augenfälligsten ist die für die Kaside ebenso wie die 
Nijäha charakteristische, ihrem Ursprünge nach auf leidenschaftliche 
tJ öl 



T3 



__ 
F p. 



u 

O <L> 

N 



w I 

fN CO 

5 



1 Martija bei Lebzeiten Ag. xxi 146, 20. 

2 Bint Karaza, vgl. Mu c ammarün 91, 5 v. u. und Note dazu. 
8 Kämil 784 ult. 

4 Vgl. den alten Trauergesang des Du-1-lsba* um seinen Stamm. Ag. in 10. 

5 Usd al-gäba v 623 wird beim Brautzug von den Mädchen folgendes Lied 

° y 

gesungen: _,/•-• > « 

r £~^ ^^** f — a~N ^^ 

Der Prophet setzt spöttisch noch folgende Zeile hinzu: 

Ein anderes ähnliches Lied, Ibn al-Fakih 53, 18 ff.: 

Auch dazu wird eine spöttische Ergänzung von 'Omar angeführt: 

Gelegentlich möchte ich auf ein altes Hochzeitsgedicht in anderem Metrum (ver- 
kürztes Mutakärib, Freytag, Verskunst 452) hinweisen, Tabaräni, al-Mu'gam al-sagir 
(Dehli, lith. 1312) 69, LA. s. v. f ^srt y m 230: 

CO 

'■5 § 

E-e 

E => 

fD O) 

to _c 

s_ C 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 






Original fronn 



312 Ignaz Goldziher. 

Bräuche 1 sich gründende Formel lä tab'ad* ,Ziehe denn fort, aber 
Gott möge dich nicht entfernen. ' 3 ,Möge öanfara nicht fern sein 
und seine eiserne Waffe und sein Sturmlauf mit ununterbrochenem 
Schritt/ 4 Keinen Sinn hat der Ausruf im Klagegedicht der Lejlä 
um Tauba: ; Möge dich Gott nicht fern sein lassen lebend und todt 
(Ulxj U**)'; derselbe ist auch schon von den alten Ueberlieferern als 
Corruptel erkannt. 5 

In formaler Beziehung kann zunächst darauf hingewiesen 
werden, dass der durch alle Halbverse durchgehende Gemeinreim 
nicht nur in Re£ez-Martijas festgehalten wird, sondern auch bei 
solchen Metra, bei denen sonst der Gemeinreim nicht angewandt 
zu werden pflegt. Zu solcher Anlehnung an das ursprüngliche Sag 4 

1 Vom Indianerstamm der Delawaren wird berichtet: ,Les pleureuses tiraient 
de toutes leurs forces sur le corps en disant: Leve-toi! Reviens parmi nous! Ne 
nous quitte pas! Ne nous abandonne pas!' Laetitia Conard, ,Les ide"es des 
Algonquins sur l'autre vie* (Reoue de VHistoire des Religions xlii 23). Von den 
Oromonen berichtet Paulitschke: ,Dem Aufbruch mit der Leiche vom Sterbelager 
gehen Proteste der Angehörigen voraus, sich vom Leichnam nicht trennen zu wollen, 
die an Heftigkeit der Bewegung das Möglichste leisten* (Ethnographie Nordost- 
afrikas, 55). Dahin gehört wohl auch noch die von al-'Abdarl im Madchal in 18 oben 
erwähnte Sitte, dass die Frauen (es ist wohl von Aegypten die Rede) die zur Voll- 
ziehung ihres Geschäftes im Trauerhause erscheinende Leichenwäscherin mit Schmä- 
hungen und Schlägen empfangen, als ob sie sie zu verhindern suchten, ihre Aufgabe 
zu erfüllen. Dies ist ein Ausdruck dafür, dass sich die Angehörigen vom Todten nicht 
trennen wollen. 

8 Nöldeke, , Beiträge zur Kenntniss der Poesie der alten Araber' 152, Muh. 
Stud. i 25. Zur grammatischen Form vgl. Ag. xix 160, 15. Reflexionen über diesen 
Klageruf in einem Gedicht bei Abu Zejd, Nawädir 23, 9 ff. Eine weiter ausgebildete 
Form: . . . O.» U-« <iJJ\ wXä^j "J Usd algaba v 556, 11, womit auch die Wendung 
zusammenhängt aJÜ\ ^>&>y> (an einen Todten gerichtet, Ag. in 147, 18), die in 
diesem Falle von dem gleichlautenden Gruss an Lebendige ( s >Joyu ^JJl «^Cä. oder 
i*fj\> i-Sß} A g- T 77 > 1> vgl. die Verwünschung y*$ b vZ^» V} <OÜ\ ^£ä* ^ *oid. 
xvni 143, 15) zu unterscheiden ist. — In moderner Todteuklage: ,Zieh nicht so eilig 
von dannen* Dalman. ,Wa» Ji ,steh auf, kehre um 4 (aus der Sammlung E. Littmanns). 



CÜ 






■o 



i fD 
O o 



(T3 



2 5 



F P. 



M_ T3 f 

CÜ 



8 Chansa 33 penult. 4 Taabbata sarran, Ag. xxi 138,9. 



6 Ag. x 78, oben. 

6 z. B. im Sari c -Gedicht der Hind bint f Otba, Anis al-gulasä (Bejrüt) 1 179, 10; 
in einem Madid-Gedicht, Harn. 414, sowie im grossen Hezeg-Gedicht, Hud. nr. 74 
durch 55 Zeilen; vgl. Ihn Ilis&m 538,10—13. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 S Digilized by L^OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Bemerkungen zur arabischen Trauerpoesee 313 

gehört auch die Erscheinung, dass vorwiegend in Trauergedichten das 
überaus häufige Vorkommen von sogenannten Musaminat-Zeilen, 1 
d. h. die Anwendung von inneren Reimgruppen (gewöhnlich durch 
Status-constructus-Verbindungen mit J^-Nomina gebildet) beobachtet 
werden kann; diese inneren Reime erstrecken sich oft auf mehrere 
Zeilen hintereinander. 2 Dies Tasmit im Trauergedichte, das von hier 
aus — wie so manche andere Eigenthümlichkeit der Martija 3 — in 
die Madih-J£aside eingedrungen ist, 4 ist eine Nachwirkung des Sa£ c 
der alten Klagerufe. Ihr Vorkommen in solchen, zum Theil sehr 
alten Dichtungen muss bei der Beantwortung der Frage nach dem 
Alter dieser Kunstform vorwiegend in Betracht gezogen werden. 
Wie in den Sag'-Klagen 6 wird ferner auch in den Trauer- 
gedichten der Name des Betrauerten gerne wiederholt angerufen, 
oder im allgemeinen wiederholt genannt. Völlig an eine alte Sa£ c - 
Nijäha erinnert z. B. die Klage der Umm-Salima um ihren in der 
Schlacht gefallenen Bruder al-Walid b. al-Walid al-Machzümi, Bruder 
des Chälid b. al-Walid: 7 

Wenn man die in der Anmerkung gegebenen Beispiele 8 betrachtet, 



t! öi 



1 Mehren, Rhetorik der Araber 169. 



o o 



ru 



«4- ~° 

O <L> 



8 Beispiele in Sawä'ir ed. Bejrüt i 84, 4—85, 1. 2; 99, 3— -6; Anis al-gulasä' 
2,2—5; 27,3; 43, 1—4; 83, 9—11—84, 1. 2 (6 Zeilen nach einander); Hud. 15, 
3 — 5. Dazu gehört auch in einem Trauergedicht der Lejlä Ag. x 78, 19 

^LUaJI J-i* * ^*^$ L-3j.-o i^sLo ^jS ^yO 
8 Vgl. Jacob, Beduinenleben 2 , 56. 204. 
4 Muf. 1, 13 ff. vgl. Zuh. 3, 31. 39 Qu J^ü), Imrlk. 34, 8; 35, 7. Hud. 79, 3. 



Ham. 614 v. 6. 

6 Vgl. M. Hartmann, Das arabische Strophengedicht i 111. Von den Beispielen, 
die im Ma'ähid al-tan§i§ (Kairo 1316) n 100 für solche innere Reime angeführt 
werden, ist das älteste von Du-1-rumma. 

6 Eine ähnliche Erscheinung findet J. K. Zenner auch in der Todtenklage 
Davids auf Saul und Jonathan, n Sam. 1, 19 — 27. (Biblische Studien, herausgegeben 
von Bardenhewer vi 67; 74 Anm.). 

7 So überliefert bei Tabaräni, al-Mu f gam al-sagir 206 unten; anderer Text 
Usd al-gäba v, 93. 

8 In der dreigliedrigen Regez-Klage über den Tod des c Amir b. Tufejl wird 
der Name 'Ämir dreimal gerufen, Ag. xv 139, 4; in den drei Zeilen einer Martija 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



314 Ignaz Goldziher. 

wird man die Charakteristik einer Trauerklage bei Abu-l- c Atahija 
verstehen : ^TjjN *L*~U\ si^-^b cuiy^ , Deinen Namen rufen weh- 
klagend die Klagefrauen/ 1 Jahjä b. Chälid al-Barmaki sagt in seinem 
poetischen Gnadengesuche an Harun al-ra6id, indem er von seinem 
bevorstehenden Tode spricht: ,Und Klagefrauen wehklagen um mich 
in finsterer Nacht mit meinen Kunja-Namen (d. h. indem sie wieder- 
holt diese Namen rufen)'. 2 

Auf ähnlichen Ursprung wird wohl auch die wiederholte Namen- 
anrufung in den Higä-Gedichten 3 zurückzuführen sein, insofern es 

00 

auch in den alten Käfija-Flüchen, aus denen das Higä sich entwickelt 
hat, auf die ausdrückliche Nennung der durch die Verwünschung zu 
treffenden Person ankam. 

Eine der hervorstechendsten formalen Eigentümlichkeiten der 
Sag c - Klage ist die wörtliche Wiederholung desselben Sag'- Gliedes, 
wie in Nr. 4 und 5 der oben mitgetheilten Proben. Dieselbe Eigen- 
tümlichkeit ist auch häufig in den Trauergedichten zutage getreten. 4 

Es ist eine charakteristische Figur in diesen Gedichten, in den 
Anfängen aufeinanderfolgender Verszeilen dieselben Phrasen zu ge- 
brauchen, nicht nur einzelne Worte 5 (wie z. B. am häufigsten die 

des Durejd b. al-Simma, Ag. ix 9, 4 ff. wird der betrauerte Chälid siebenmal an- 
gerufen : 






w i 

fN CO 



'S? £ 

= 1 

- "r? 

F P. 



Vgl. noch einige Beispiele hiefür: Harn. 369. 402. 425. 440. 451. 466. 496. Ag. x 77, 
23; xi 128, 7 ff.; xvr 84, 10. 11. 

1 Abu-l-'Atähija, Diwan (Bejrüt) 1 60,6. 

2 Bejhaki ed. Schwally 574, 9 LoUL ^**53\ CUs? ^^-o^o ^W 
8 Vgl. besonders Hud. 7. 8. 9. 53. 119. Aus b. Hagar ed. Geyer 5, 1—5. In 

einem Higä des Gerir gegen al-Achtal wird der Name des Geschmähten (in der 
Deminutivform JJa^L\ ZDMG. Lt 264) in vier aufeinanderfolgenden Zeilen fünf- 
mal genannt, Gamhara 169, v. 13—16. 

4 Ja selbst das ganze Trauergedicht (freilich nur, wenn es ganz kurz ist) wird 
mehreremal wörtlich wiederholt: Olo^l «ijb >>3} C5^ OJLää.^, Ag. vii 30, 18. 

6 z. B. Mälik b. al-Rejb, Gamhara 143 v. 18—21. Ibn Kajs rukk. ed. Rhodo- 

kanakis 41, 8 ff. 

ifl In 

£ -o 
-ö v 

E-e 

E => 

fD O) 

-i n>,-.i,^h U t Original from 

s 8 Digmzeo üy Vj CORNELL UNIVERSITV 






CÜ 



cn 



(T3 



2 5 



CÜ 



Bemerkungen zur arabischen Trauerpoesie. 315 

Häufung fragender Pronomina und Partikeln : * • • • ^^ • • • £?*$ 
c?*})) sondern auch ganze Sätze; es gilt in diesen Gedichten als 
stimmungsvoll, in aufeinanderfolgenden Zeilen identische Halbverse 2 
aufzuweisen: 






3c 



oder in dem Grabgedicht des Saddäd ibn al-Aswad über die bei 
Bedr gefallenen Mekkaner, deren Leichname der Prophet zu Häuf 
in eine Cisterne werfen Hess: 4 

,Was ist alles in der Cisterne, der Cisterne von Bedr (untergegangen) an 

Sängerinnen und edeln Zechgenossen, 5 
Was ist dir alles in der Cisterne, der Cisterne von Bedr an Näpfen mit 

Höckerfett bekränzt 6 
Wie viel ist dir in der Cisterne, 7 der Cisterne von Bedr an grossen Kamel- 



heerden und weidendem Vieh; 



ö. jy 

1 c Ant. 24, 2. 3; Sawä'ir i 46, 3 ff. Auch Abu Nuwäs, der sich in seinen 

~ o 

Liedern von den alten Canones möglichst emancipirt, wiederholt in einem Trauer- 
gedicht das Fragwort <>$+ 13 mal in aufeinanderfolgenden Halbversen und schliesst 
V. 8 diese fragende Aufzählung mit +$+ ^j»*, Diwan ed. Iskender Asaf (Kairo 
1898) 140. Dazu gehört auch das wiederholte Lo\Iä.\ in der Anrede des Imru'-ul- 
Kajs beim Grabe am Berge c Asib, Ag. viu, 73 unten. Ein ähnliches Gedicht wird bei 
ähnlicher Gelegenheit dem Sachr b. c Amr zugeschrieben, Mejdäni ii 37. In anderen 



Versionen wird Lo\Ia*\ dreimal wiederholt. Später hat man die Stelle für die 
Grabesstätte des Imru 1 ul-Kajs selbst oder des Sachr gehalten, Ibn Challikän nr. 794 
s. v. Walid b. Tarif. Bei Abu Hiläl al- c Askari, Magma' al-amtäl (ed. Bombay) 96 bis 
oben, wird der Berg als i>oj^J\ oyu bestimmt. 

a Lebid, ChaM. 19 v. 3. 4; Muf. 17, 2—4; Hassan 121, 13—15; Hud. 112, 2—6, 
Hut. 67, 18—20; Wright, Opusc. 109 oben; 117, 5 ff.; Ag. n 181, 8 v. u. ff. Sawä'ir 
i 92, 3—5; Ham. 459; 475; Kämil 721, 10—13 u. a. m. 

8 L. A. s. v. ^ß\j xix 3. 

4 Ibn Hisäm 530, 13-16 yo *~~JLä <_^JüUb \3> Ui. 



5 d. h. an Leuten, die die Gastfreundschaft und Freigebigkeit pflegten. 



6 Vgl. Note zu Hut. 28, 2. 



3 o 

7 In den folgenden beiden Versen wechselt die Wiederholung mit einem Sy- 
lt} •• m 

nonym von «^^JlS ab: *jo ,£^i> .£^k)l> ^>5ü ^3. Die Verse sind mit wesentlicher 
Textverschiedenheit bei Abu-l- e Alä, al-Ma'arri überliefert, JRAS. 1902, 299. 818. 

£ -o 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

c _Q 
O Q_ 



Original from 



316 Ignaz Goldzihbr. 

Wie viel ist dir in der Cisterne, der Cisterne von Bedr an Fähnlein (der 
Weinbuden) und grossen Bewirthungen.' 1 

Diese Eigen thümlichkeit, die von hier aus wegen der Gemein- 
samkeit des schildernden Elementes auch in das Nasib-Gedicht 2 und 
überhaupt in poetische Stücke eingedrungen ist, in welchen rühm- 
liche 3 oder — wie im Hi£ä 4 — auch gegentheilige Eigenschaften 
schildernd aufgezählt werden, 5 und die von der geistlosen Poesie 
der Decadence als blosse alterthümelnde rhetorische Schönheit auch 
in anderen Arten der Dichtkunst verwandt worden ist/ galt wohl 
ursprünglich als charakteristisches Zeichen der Todtenklage. Durch 
ihre Anwendung beabsichtigte man mit der entwickelten Trauerpoesie 
den Eindruck der alten Nijäha hervorzurufen, 7 während sonst die 
Wiederholung desselben Elementes in dem Gedicht als sehr hässlich 
gemieden wurde. 8 Man kann in diesen Gedichten sehr leicht Gestal- 
tungen beobachten, in welchen die soeben erwähnten Wiederholungen 
den Uebergang von der Nijäha zur Martija sehr klar veranschau- 
lichen. 9 Andererseits erscheint die Wiederholung zuweilen nur noch 
als verkümmerte Formalität; wenn z. B. die wiederholten Elemente 
nicht unmittelbar hintereinander folgen, sondern, wie in der dreimaligen 



CÜ 



ti öl 



F P. 



1 Vgl. Note zu Hut. 16, 18. 

2 Mb. 7, 22—24; Imrlk. 63, 4. 5. 7. 'Omar b. abi Rabfa (ed. Kairo) 34, 3 
v. u. ff. Ag. vin 144, 17 ff. 

Tar. 5, 51—52; Muf. 23, 33—36; Hassan 100, 15-18, Hud. 155, 5—7. 



i 

n 
O) 

3 

4 Ag. ix 9, 23. 

O E 



ihrer Dichtungen sind, damit, dass sie ,diese Gedichte sprechen, während ihre Lebern 



6 Einen anderen Ursprung hat die Wiederholung der Halbverse in volles- 
thümlichen religiösen Madih-Gedichten und Busslitaneien (istigfär), wie z. B. bei 
Boüriant, Chansons populaires 78; 143. Hier sind die Wiederholungen versificirte 
Nachahmungen derselben Eigentümlichkeit in der Prosa-Litanei. 

6 Auf diesem Gebiet kann als das äusserste angeführt werden, dass Ibn 
Kajjim al Gauzija in seinem trockenen dogmatischen Lehrgedicht Nünijja zur Er- 
höhung der Wirkung seiner Polemik diese figura repetitionis anwendet; vgl. das bei 
Älüsi, Gala al-*ajnejn fi muhakamat al-Ahmadejn (Büläk 1298) 256 mitgetheilte Stück. 

7 Ein Beduine motivirte die Thatsache, dass die Maräti die gelungensten 

> 0) 
C CT 

von Gluth verzehrt werden' ^jZs? U:>US\j Jyü ü^ G&hiz, Baj&n n, 36, 10. 

8 Bejhaki ed. Schwally, 463. 

9 95. B. Ag. vn 30, 15. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zur arabischen Trauerpoesie. 317 

Wiederholung des Halbverses: aJÜjw*. ^1* ^P»-^. ^ j*^3 in einer 
berühmten Trauerl^aside des Abu Du'ejb, durch viele Zeilen von 
einander getrennt sind. 1 In dieser vom Ursprung am weitesten ent- 
fernten Form kommt dies äusserliche Residuum der alten Nijäha 
nur noch in völlig verblasster Weise zur Erscheinung. 

Abu Nuwäs, der die überlebten Eigenthümlichkeiten der alt- 
arabischen Poesie gerne zum Gegenstand des Spottes machte, 2 hat in 
einem seiner Mu£ün-Gedichte auch solche Wiederholungen parodirt, 3 
die man in den den alten Maräti- Gedichten nacheifernden neueren 
Trauerkasiden immer anzubringen strebte. 4 §afi al-din al-Hilli hat 
in seinem Trauergedicht auf den Tod des Mamlukensultans al-Melik 
al-näsir Muhammed b. Ealäwün (st. 742) sieben Strophen, die hinter- 
einander mit dem Wörtchen ^ resp. ^ beginnen, andere sieben 
mit dem Anfang <^*. 5 Sein jüngerer Zeitgenosse Zejn al-din 'Omar 
b. Muzaffar al-Wardi bekundet dieselbe Eigentümlichkeit in einer 
Martija, die zu seinen frühesten Gedichten gehört. 6 Ausser anderen 
üblichen Wiederholungen beginnt er vier aufeinanderfolgende Zeilen 
dieses einem Bedr al-din gewidmeten Trauergedichtes mit den An- 
rufungen : 

. . . lli^ ULI C*J6 ^jJI jj^\ .... JU-j ^jJj Ja ^j^\ js*>\ 

Dieselbe Figur wird endlich gegebenen Falles auch in der auf volks- 
tümliche Wirkungen berechneten Litteratur der arabischen Helden- 
romane angewandt. So bot z. B. die Sirat \Antar sehr oft Gelegen- 



T3 






w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 






u 



<u 



TD 



1 Gamhara 129 v. 11; 131 v. 5; 132 v. 4. 

* Abhandl. zur arab. Philologie, i 145, Anm. 2. 

8 Al-fakähat wal-itinäs fi mugün Abi Nuwäs (Kairo 1316) 54. Der Inhalt 
dieses Heftes ist aus dem grossen Abu Nuw&s-Werk des Hamza b. al-Hasan al- 
Isfahäni (Berlin, Ahlwardt 7532, vgl. GOA. 1899, 456) entlehnt. 



4 Eine Parodie solcher Wiederholungen finde ich auch in dem Gedicht bei 



Abu-1-Mutahhar al-Azdi ed. Mez 110, unten, obwohl dies Gedicht keine Martija ist. 

5 Diwan des S. al-din al-Hilli (Damaskus 1297) 262—263. 

6 Diwan in einem Stambul 1300 von der Gawä'ib-Druckerei herausgegebenen 
Sammelbande (Diwan des Wardi, 131—341 Poesie und rhetorische Prosa) 261, 



v. 12—15. 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



318 Ignaz Goldziher. 

heit zur Production von Trauergesängen. So oft einer der vielen 
Recken auf dem Schlachtfelde fällt, oder geliebte Personen hingerafft 
werden, umstehen die Ueberlebenden ihren Leichnam und recitiren 
Trauergesänge, die, im Sinne der Absicht dieser Erzählung, bei aller 
Volkstümlichkeit, berufen sind, den Eindruck des Altertümlichen 
hervorzurufen. Und dabei kehrt immerfort die charakteristische Eigen- 
tümlichkeit der gehäuften Wiederholung einzelner Verstheile wieder. 
Das Trauerlied des 'Absitenhäuptlings Kajs b. Zuhejr auf seine 
Mutter Tumäcjir beginnt jede der fünf ersten Verszeilen mit der 
Formel: . . . cr ^ b "Jl (ed. äähin ix 197); in der Martija des 
f Antar über seinen Sohn Gasüb (ibid. xxvi 110) beginnen drei 
aufeinanderfolgende Zeilen mit dem Rufe • • ^ c^^-ai *xäSj und 
noch augenfälliger tritt diese Eigentümlichkeit hervor in dem 
Trauergedicht des Helden über den Tod seines anderen Sohnes 
Ga<Jbän (xxv 77 — 79). Neun Zeilen beginnen hintereinander mit 
dem Rufe ■ - • vi^U s\ ; dann folgen acht mit dem Rufe : J^* b l 
* • • cr^y* dann eine Gruppe von vier Zeilen mit dem Anfang >&Sy>-s 
U^a£ b und dann noch fünf aufeinanderfolgende Versanfänge mit: 

Auf dies Moment der Trauerpoesie hat c Ali al-MurtacJä 'Alain 
al hudä in einem Abschnitt seiner Gurar al-fawäid, wo er die 
Figura repetitionis im Koran und in der alten Poesie behandelt, ge- 
achtet. Da die lithographische Ausgabe (Teheran 1772) dieses in 
philologischer und theologischer Beziehung reichhaltigen Werkes nicht 
viel zugänglicher ist als es die Handschriften desselben sind, wird 
es nicht überflüssig sein, wenn ich die betreffende Stelle im Text 



.c o 



w I 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



hieher setze: * 

F p. 



<J>jt* **<£) cr> J^-^ J ü ^Äjbu£,\^ *~>j*& &$ er* j~£ \J*$ 



O O) • •• 






> <u 

C CT 

=> O 

— o _ 

c O 

1 Gurar al-fawä'id wa durar-al-kalä'id 84. 

2 Var. <*~UÜ\. 

'■5 § 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zur arabischen Trauerpoesi«. 



319 



TD 



.c o 



w I 

f\l ^ 

, O) 

O o 

c w 

o E 



£ ö- 
o ö 



u 

O <L> 

*S 

■h! ■— 

'i/i öi 

> <U 

C CT 

3 O 

— O 

c O 

CO 

.E -ö 

-ö £ 

E-e 

E => 

fD O) 

■o E 

(U o 

ü Q_ 



j^jJx )\ ^r? *Ua*)\ vJ^-j \>\ 

f f.t - ' ' c ' 

"V ** * "V / ' 



i^Jüi er* ^^i ^~^ \ ^^ 



9 r / 






v aSUL CU>L^ ^^yi b ^ 5 -iLftJ\ ^-«J^ 

*<> iLü ^55b\ ij<J\ CUiV ^^jJ 

2Jv>. Ä-fiJ ^5b\ r ; -J\ C-O'J ,J^^-«J 



»wk- 



-*-^ uÄ^ "r^* c^ö^ \£r**^ 



\ — ^S v-jy b UJ oUJ\ ^5 ^J ^Sl 



J — *l>^ 1 ^Z 13 ' o<^ C 1 ^-^ H^^ 
ff , 

J JU ONU.U bUJ\ dT»J^ 

6 ^ [^] ^li.\ Jb*_j Ub/5 U ^ ^ 5 LgiSj^ 



1 Ag. iv 147, 4 v. u. iJ*^ 

2 Ag. Oj^. 

3 var. ,b^b. 

* V * 

4 Margo: J.S^ "J <^J ^^-^3' ^j», j. 

6 var. bbbxXfi. 

6 Ag. iv 150, 2 (Delect. 44, 1); in dem dort mitgeth eilten Text findet sich 
die hier dargestellte Wiederholung nicht. 



rOO 



gle 



Original from 
CORNELL UNIVERSITV 



320 IGNAZ GOLDZIHER. 

III. 

Das Amt der Todtenklage war mit dem Begräbniss nicht ab- 
geschlossen. Ganz ebenso wie noch heute, 4 hat man auch in alter 
Zeit nach dem Begräbniss eine Trauerperiode eingehalten, während 
welcher Zeit die Todtenklage vor den versammelten Trauergästen 
fortgesetzt wurde. Geschichtlich völlig werthlos ist freilich die in 
der Sirat c Antar erhaltene Mittheilung, nach welcher der Held dieses 
über vorislamische Verhältnisse berichtenden Romans nach dem Tode 
seines Vaters einige Zeit in einem eigenen Trauerhause, bejt al- 
ahzän 6 die Trauerbräuche übt und die Beileidsbesuche der Freunde 



ti öi 



Cl 



I (ü 
O o 



(T3 



1 = U*S CU-o ij+*. 

2 Text: JL^I 
8 Text: f«^o, marg. v^j^o- 

4 z. B. in Mekka unter dem Namen f Udda, Snouck Hurgronje, Mekka n 
194 ff. Aus Syrien, Dalman, Palästin. Diwan wird die Benennung 1 solcher Klage- 
versammlung als me'äda angegeben; der dabei gesungene Trauergesang ma'id 
(nach Ergänzung und Berichtigung: mi^edijje, plur. mi"edijjät). Für Aegypten 
findet man eine lebendige Beschreibung solcher Versammlungen (hidäd) im Anhang 
des europäischen Reiseberichtes von Ahmed Zeki 475 — 483. Das Hidäd wird 40 Tage 
lang, ausser den drei ersten Tagen nach dem Todesfall, jeden Donnerstag geübt. 

5 Dass dies bejt al-ahzän ein Element der Volkserzählerphantasie ist, wird 
auch daraus ersichtlich, dass man ihm auch in Taus, eine N. (Büläk 1279) n 32, 13; 
51, 19 (in der Erzählung von König Sahramän und seinem Sohn Kamar al-zamän) 
eine Stelle gegeben hat; es ist aus der Art der Verwendung dieser Einrichtung 
ersichtlich, dass der Erzähler keinen rechten Begriff davon hatte, was man sich 



2 75 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Bemerkungen zur arabischen Trauerpoesie. 321 

empfängt. 1 Es ist nicht anzunehmen, dass für solche Todtenklage 
eine festgesetzte Frist bestimmt war. In älterer Zeit (Lebid 21, 6), 
sowie auch in späteren Berichten ist zuweilen von einem ganzen 
Jahr die Rede, während welcher Zeit zunächst die nächsten Frauen 
die Todtenklage um den Verstorbenen übten, wobei sich die Gewohn- 
heit entwickelte, dass Nachbarinnen und gute Freundinnen den kla- 
genden Frauen in diesem Beruf behilflich waren. Für die Bean- 
spruchung dieser Mithilfe familienfremder Frauen bei der Todten- 
klage hatte man den Terminus ^Iä^oJ. 2 Muhammed verbietet den 
Frauen, diesen Act der freundschaftlichen Theilnahme zu üben: 3 
?V^I ^ ^ifi ^ >\sm\ ^. Man dürfe niemand in der sündhaften 
Handlung der Nijäba 4 unterstützen. Aber wir werden gleich sehen, 
dass ein solches Hadit nur die Ansicht der puristischen Vertreter 
des Islam reflectirt, und dass es nicht an Bestrebungen gefehlt hat, 
diese alten Bräuche im Sinne der islamischen Lehre zu leffitimiren. 
Aus vorislamischen Einrichtungen 5 hat sich, trotz aller Proteste, 
der auch in der ersten Zeit des Islam allgemein übliche Brauch 
erhalten, das Andenken theuerer Verstorbener noch einige Zeit nach 



darunter zu denken habe: , sZZj ^Ua.'Vl CU-o »L»*^ ^-^ ij* C^iT?* e ^~^i r*^ 

***** ^ d-r^\ <J*- 

1 Bejt al-ahzän wird auch die Stadt genannt, in der Jacob wohnte, als er 
um den Verlust des Josef trauerte; Kazwini ed. Wüstenfeld ii, 104. 

2 Die Construction ist: ^\l» ^A& ü^a IavXjimjI: man hat die Frau N. als 
Aushelferin (bei der Trauerklage) um N. eingeladen. Usd al-gäba v, 590, 4: vJUlls 

c tn 
O E 



w I 



(T3 



fU 



fU 



«^ ^i V3 ty^JUa» ^» jjo j\ ^ ^U ^U J^UaS Vgl. eine andere Ver- 



2 5 
= 1 

sion bei Nasa i, citirt im Madchal des 'Abdari in 7. 



3 S. die ausführliche Erklärung in Nihäja s. v. joiaaj ii 161 und erweitert 
in LA. s. v. iv 201. Vgl. noch den Dichter des v. Jahrhunderts Ibn Hamdis (st. 527) 



u 

«4- ~° 

O <L> 

ed. Schiaparelli 330 v. 16 beim Tode seines Vaters: 

> <u 

3 o 

Der Dichter befindet sich in weiter Ferne von der Heimath. 



<**£»UU\ ^£ y*4 ^ Jesuit \J^ * wXäAw> ^Xft ^Sj^S vj^snj^. 



4 AfwÄ. ÄteA i 251. 



5 Wellhausen, Heidenthum 1 160, 31. 



.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



322 Ignaz Goldziher. 

dem Begräbniss 1 in eigenen Trauerversammlungen (hebr. misped) 
zu ehren, wobei auch Trauermahlzeiten (wadima) 2 stattfanden und 
die Todtenklage noch einige Zeit fortgesetzt wurde. Solche Trauer- 
versammlungen nannte man manaha, plur. manäjih* oder matam 
plur. madtim* 

Nach dem Tode Hasans hielten die häsimitischen Frauen 
noch einen Monat lang Klageversammlungen ab. 5 Am Anfang der 
'Abbäsidenzeit veranstaltet die Mutter eines c Abd al-Ma£id mit den 
Schwestern und Sclavinnen des Verstorbenen eine Trauerversamm- 

00 

lung, in welcher die Frauen wiederholt Weherufe ertönen lassen. 6 
Wenn in dem Bericht darüber gesagt wird, dass ,sie die erste war, 
die diesen Brauch im Islam geübt hat', so kann man dieser Be- 
merkung keinen Glauben schenken, da die Traditionarier ganz un- 
bedenklich berichten, dass der Prophet seiner Gattin Umm-Salima 
die Erlaubniss ertheilte, an einem ma'tam theilzunehmen, das die 
Machzüm- Frauen zur Betrauerung ihres Stammgenossen Walid b. 

Walid abhielten. 7 Dies deutet darauf, dass die Sitte, trotzdem sie 



1 Aus einem Verse des Zejd al-chejl (bei Abu Zejd, Nawädir 80, 7) könnte 
man folgern, dass solche Klageversammlungen sich jährlich wiederholten: ^S ^J*\ 

8 Vgl. Glosse zu Ibn Hisäm 796, 16 (ed. Wüstenfeld ii 184). 



ti öi 



» Ag. vm, 104, 14 ^UJ» cyJ*.. 

4 Ein Matam beim Grabe, Husajn b. al-Humäm Muf. 13, 28, wo jedoch auch 

^ O) 
^ u 

,ma'tam schwarzgekleideter Frauen, die für die Todtenklage Trauer anlegen* (Jäküt 
° o 

iv 425, 19). Davon bekam das Wort ma'tam sehr früh die allgemeine Bedeutung: 

o 2 



(T3 



F p. 



u 

O <L> 



> <u 
=) o 



die das Begräbniss begleitende Todtenklage gemeint sein kann. Al-A e £ä redet vom 



Frauenversammlung ohne Rücksicht auf den Zweck der Zusammenkunft; z. B. 
Tamim b. Mukbil, Gamhara 162, v. 3. Um solchem Missverständniss zu entgehen, 
will Ibn Kutejba (Adab al-kätib ed. Grünert 24, 6 ff.) die Trauerversammlungen 
lieber mandfya nennen lassen. Eine andere Verallgemeinerung des Wortes matam 



ist seine Anwendung auf die Trauer, auch wenn sie sich nicht in Versammlungen 
kundgibt (Wright, Opusc. arab. 115, 11, 'Ikd. in 85 ult.). 
6 Tab. m 2333: c ^jj\ ^£,1* ^ *Uo f l5\. 

6 Ag. xvii 14 unten: A^le, U3'U AJ^tja^ ^os.\-J\ v>-^ 0\>ä.I gw> CU-A5\^ 
f ^Uü^l » aJU"^ vi^JS J**i ^ jj*\ L f i\ JÜLwS Afj ^2 tej ^\^ <^-aJ CU*\Sy 

7 TabarUni, al-Mu^am al-sagir, 206: <*jj\ J<^ b CUJIS (iJU ?\) l*3l 



Jl äXj' ^ CUJULdj vgl. oben S. 313. 
.E -o C *" * 

-ö v 

E-e 

E => 
ro <D 

£ ro ^ I 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 
TD 



ti öi 



* 



<=> o 



> $ 

F P- 



«4- "° 






(U <fl 



Bemerkungen zur arabischen Trauerpoesie. 323 

mit ihrem Ursprung im Heidenthum wurzelte und aus diesem Gesichts- 
punkt manchen religiösen Anfechtungen ausgesetzt war, in den 
ersten Generationen des Islam, also sicher auch vor der abbasidischen 
Zeit, geübt wurde und dass den Puritanern, die sie missbilligten, 
die Autorität des Propheten entgegengestellt wurde. Auch wenn der 
bei dem Ma'tam für f Abd al-ma£id mitwirkende Dichter Ibn Munädir 
sein Trauergedicht über den Verstorbenen mit den Worten beginnt: 
Fürwahr, ich will ein Ma'tam abhalten U3'U ^^ii^ 1 so zeigt dieser 
Ausdruck, 2 dass damit die Sitte als eine allgemein übliche, seit 



1 Ham. 271, 1: ^^l ^tj\ ?*$$ vgl. Ag. xvi 49, 16: £ä.UJ» ^Jlä f lSU. 
Iä^^o; Gähiz, Buchalä 124, 3. £ä.U-JI Cr ^\ yX3 <JUJl Ja\. Dies f lS iv (vgl. Kämil 
74, 8. 9) drückt den ceremoniellen Charakter der Uebung aus; vgl. ä^aJ\ ? lä\. — 
^äUaJL £5$J\ \^^S\, Bagawi, Masäbih i 44; dann im allgemeinen: eine formelle 
Pflicht erfüllen; z. B. in einem Hadit bei Damiri (s. v. äS\>) n 403: <UJ\ hit jJU 

Ai * Ä \ »*i O^* J 1 ^. ^ crTC* ^ l-aIIää ^ T^. 

* Für den formalen Charakter der Zusammenkünfte dient später auch das 
Wort jsjLft, z. B. bei Bedf al-zamän al-Hamadäni (Rasä'il ed. Stambul 237), wo die 
Unterlassung aller Trauergebräuche verfügt wird; die Stelle ist auch aus diesem 
Gesichtspuukte wichtig: ^^ «l«.sc£ *j Jsi. ^kb^ <^a*LU d<^s> JuLso ^^1 

* äL S f^4?, ^ o^r* 5^ ^5 t }cu 3j*^^3 S-^ >y^i ^3 Si.3 L^^i' 

Zu den in Muh. Stud. i 246 Anm. 2 zusammengestellten Notizen über Trauer- 
gebräuche der Araber kann man jetzt auch 'Umära al-Jemeni ed. Derenbourg i, 18 
hinzunehmen : Zerbrechen der Schwerter und Bogen, Tödtung von Rossen als Trauer- 
gebräuche für hochgestellte Personen (Südarabien). Aus Usd al-gäba (iv 284, 4 ff.) 
ist ersichtlich, dass man beim Begräbniss eines Feldherrn über seinem Grabe Fahnen- 
stangen zu zerbrechen pflegte. Bei dem des Mälik b. 'Abdallah al-Chat c ami zer- 
trümmerte man deren 40, nach Zahl der Feldzüge, die dieser Heerführer unter den 
ersten Omajjaden gegen die Griechen mitgemacht hatte. In entsprechender Weise 
drückt sich die Trauer um gestorbene Gelehrte durch Zertrümmerung der mit ihrer 
Thätigkeit zusammenhängenden Gegenstände aus. Nach dem Tod des Imäm al- 
haramejn brach man in der Moschee das Minbar ab, das dieser Gelehrte zu besteigen 



Y* ^° &i X> e 3 JW5 Y* 



j" 



pflegte (Ibn Challikän nr. 388, Ende) und dankbar trauernde Schüler gaben ihren 
Gefühlen damit Ausdruck, dass sie auch ihre Tintenfässer und Schreibfedern zer- 
brachen (Ibn 'Asükir, ed. Mehren, Expose de la JUf&rme de Vlslamisme, 154, 10). 
Nach dem gewaltsamen Tode des grossen Traditionariers von Nisabur, Mu^ammed 
b. Jahjä al-Duhli (st. 267) wurden die Tintenfässer der Scholaren durch drei Jahre 
verborgen gehalten ( ^Islv*J\ CU^^-) bis wieder ein ebenbürtiger Lehrer sich an 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 22 

E => 

in 4-/ 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



T3 



(T3 



F p. 



u 



324 Ignaz Goldziher. 

alter Zeit unter bestimmten Gebräuchen stattfindende Feier voraus- 
gesetzt wird. 

Sowie über jene Gebräuche, welche die beim Begräbniss selbst 
stattfindende Todtenklage begleiteten, 1 so haben wir aus alter Zeit 
auch über die Bräuche bei diesen Ma atim keine speciellen Nach- 
richten. Aus sehr später Zeit begegnet uns wiederholt die Angabe, 
dass man bei solchen Trauerfeiern das Haupt entblösste. 2 Es kann 
nicht behauptet werden, dass dies arabische Sitte sei; sie wird 
wohl in der Volkssitte jener muhammedanischen Völkerschaften be- 
gründet sein, von denen ein solcher Brauch berichtet wird. Er wird 
z. B. aus dem iv. Jahrh. d. H. von den dejlemitischen Muhammeda- 



ihre Spitze stellen konnte (Dahabi, Tadkirat al-huffäz, ed. Haidaräbäd, it s. v.). — 
Ueber dem Grab gewöhnlicher Leute wurden alltägliche Gebrauchsgegenstände zer- 
brochen (Gähiz, Buchalä, 54, 8). — Unter einen andern Gesichtspunkt gehört es, 

dass das Volk in Granada nach dem Begräbniss des hochgeachteten frommen Ge- 

■ö 

lehrten 'Abd al-Mun'im ibn al-Gars (st. 599) die Bahre, auf der dessen Leichnam 
getragen worden war, in Stücke zerbricht, um dieselben unter einander (als Amu- 
lette) zu vertheilen: * >% ,<I*3ü^ &äj6 ^UJl j~*£) ( Ibn Farhün, al-Dibäg al- 
mudahhab, ed. Fes 1316, 210). Dies scheint specieller Volksbrauch im islamischen 
Spanien gewesen zu sein. Er wurde nicht allgemein gebilligt. Bei der Beerdigung 
des Muhammed ibn Lubäba in Cordova (st. 314) wurden Stimmen laut, dass man 

in ^ 

sich herandrängen möge, um dem frommen Lebenswandel des Verstorbenen nach- 
zueifern, nicht aber um Spähne von seiner Todtenbahre zu erhaschen: ^&JljL 

du^ju ^Js. ^ (Ibn Faifcün, l c. 230). 

1 Dahin können wir allerdings die Ag. n 138, 8; x 58, 3 v. u. überlieferte 
Nachricht rechnen nach welcher die Frauen die Todtenklage um ihren verstorbenen 
Gatten stehend abgehalten haben, wenn sie die Absicht hatten, fortan im Wittwenstand 



zu verbleiben und sich nicht wieder zu verheirathen. — Auch sonst wird die stehend 
iE ^ 

gehaltene Todtenklage als Zeichen erhöhter Trauer hervorgehoben; ich denke au 



Ibn Kajs al-Rukajjät 41, 7 (ed. Rhodokanakis 190) l^'yL)* l$~*i <-^o ,J^-> c^<^ 
i^JUI üb^iwÄ^A ,allein (ohne dass ihr jemand beisteht, ^Ijc*o\), , stehend 4 . 

2 Wie im allgemeinen bei der Züchtigung Modalitäten angewendet zu werden 
pflegen, die aus den Trauerbräuchen stammen, so wird auch die Abnahme der 
Kopfbedeckung als Correctionsstrafe (ta'zir) angewandt. Sachaü, Muhammedanisches 
Recht 849, 4. Als beschämende Strafe wird erwähnt, dass man jemandem den Kopf- 
bund um den Nacken legt. AjLLs. ^Js ^X^^e. \^J&^ Musabbihi, bei Becker, Bei- 
träge zur Geschickte Aegyptens y i 65, 9, über die Bedeutung s. Dozy, Dictumnaire des 
vitements arabes 310 f. 

E-e 

E => 

fD O) 



Original fronn 



1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Bemerkungen zur arabischen Trauerpoesie. 325 

nern erzählt; sie entblössen das Haupt bei den Trauer Versammlungen ; 
sowohl die Leidtragenden als auch die Condolenzgäste hüllen (statt 
der regelmässigen Kopfbedeckung) ihre Kleider dicht um Haupt 
und Bart. 1 Dasselbe ist um dieselbe Zeit in Bagdad, wie es scheint, 
beim Tode sehr bedeutender Männer üblich. Unter den Trauer- 
kundgebungen um den grossen Theologen Abu-l-Ma'äli al-Guwejni 
(st. 478), den Lehrer des Gazäli wird erzählt, dass in der Zeit 
zwischen seinem Tod und seinem Begräbniss ,die Kopftücher (al- 
manädil) von den Häuptern abgelegt wurden und dass keiner von 
den Grossen und Vornehmen gewagt hätte, das Haupt zu bedecken'. 2 
Aus dem Jahre 687 erhalten wir die Nachricht aus Aegypten, dass 
nach dem Tode des Malik al-§älit, des Sohnes des Sultan al-Malik 
al-Mansür Kiläwün, dieser mit entblösstem Haupte in seinem Gemach 
sass, seine Mütze föyü calote) lag auf dem Boden, während er 
selbst schrie und weinte. Auch die Emire und Beamten, die ihm 
ihr Beileid zu bezeigen kamen, warfen ihre Mützen zur Erde. 3 

Wenn es auch in den oben angeführten Beispielen immer der 
Familie angehörige Frauen und theilnehmende Freundinnen sind, 
die die Trauergesänge bei den Ma'ätim anstimmen, so wird sich 
auch bei diesen Trauerversammlungen schon in alten Zeiten ganz so 
wie bei der dem Tode unmittelbar folgenden Nijäha auch den Mieth- 
klagefrauen ein weites Wirkungsgebiet eröffnet haben. Du-1-rumma 
vergleicht in der Beschreibung eines Karawanenzuges das Heben 
und Senken der Beine der ziehenden Kamele mit (den Bewegungen 
der Klagefrauen bei) einem ,gemietheten Ma'tam', d. h. der ge- 



ti öi 



w i 

fN CO 

° m 



o 2 



(T3 



* 3 

F P. 



1 Mukaddasi ed. de Goeje, 369, \^a^XsJj ^-coa» lyu&i ^'Lo ^J ^JS \}\^ 

2 Ihn c Asäkir ed. Mehren, Expose' de la Reforme de VIslamisme etc. (Leiden 
1878) 154, 6: cr oj / J\ ^ JjoLLJI CUävo^. Es ist nicht ersichtlich, welche Ent- 
blössung (des Hauptes, der Arme?) mit .^a. gemeint ist, das als Trauerkundgebung 
bei der Beerdigung des Baki b. Machlad (st. 276, Cordova) erwähnt wird; dieser 
Trauergebrauch wird sehr getadelt jJUJLl ^s. j*»X\ A£i\ ^s bb £^oj ^^ ^j^3 

^ Ihn al-Fara(Ji, ed. Codera i 83. 

3 Ibn Ijäs, Ta'rich Misr (ed. Kairo) i 117 unten. Entblössung des Hauptes 
Zeichen der Bestürzung, Geschichte von Sül ed. Seybold 36, 2: Reue ibid. 57 ult. 

22* 

'-o v 

E-e 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

o3 £ . 

BBW" 

ü Q_ 



Original fronn 



326 Ignaz Goldziher. 

werbsmässigen Klagefrauen, die für eine solche Trauerversammlung 
gedungen werden und die ihr Handwerk nach allen Regeln der 
Kunst zu Gesicht und Gehör bringen. 1 

Nach dem Tode von Fürsten scheint man während der ersten 
Trauertage als erhöhte Trauerkundgebung auch noch die Thore der 
Residenzstadt geschlossen zu haben. Dies wird wenigstens von der 
Trauer um den Chalifen al-Kä'im berichtet. 2 Die Bazare wurden 
bei dem Tode vornehmer Leute geschlossen. 3 Bei Vornehmen und 
Geringen hat sich aber gleichmässig der Brauch entwickelt, dass die 
nächsten Leidtragenden während der ersten Trauertage ,zum Em- 
pfang der Condolenz sitzen' *\y*ti c ^ > )JL\ ? d. h. solche Besuche cere- 
moniell empfangen. Die Todtenklage wird mit diesen Condolenz- 

6 

Versammlungen combinirt. Während derselben recitiren auch die 
Dichter ihre Trauerkasiden. 4 

Auch der einige Tage nach dem Begräbniss übliche Besuch 
des Grabes, an welchem man auch die Klagefrauen theilnehmen lässt, 
wird mit der Fortsetzung der Todtenklage im Zusammenhang stehen. 
Am dritten Tag (oder Dienstag) nach der Beerdigung der Bäna, 5 
der Geliebten des Dichters Ibn Munädir, zogen alle ihre Mädchen 
zu ihrem Grabe. Der Dichter, der sich ihrem Zuge anschloss, 

schildert ihn mit den Worten: 6 

in 

=5 
I 

,Heut' ist Dienstag — der dritte Tag der Bäna; 
Viel Gazellen sieht man heut' am Kirchhof.' 



ti öi 



Cl 



<=> o 



(T3 



2 5 



03 



fU 



1 Arägiz al-arab ed. Muhamr^ Taufik al-Bekri (Kairo 1313) 9, v. 3. ^j\S 

2 Becueil des textes . . . seldjoucides ed. Houtsma i 51, 10 ff. 

8 Nach dem Tode einer Enkelin des 'Ali ist das erste, was der Präfect von 
Medina anzuordnen hat Jjl^o^M «itj> ^J Ag. xvn 88, 20 ff. — Dasselbe geschah 
bei dem Tode grosser Gelehrter; bei solchen Fällen ist überaus häufig die Nach- 
richt A3yo f> f> L 5\ 5 x^^\ jJ3\ CUÄji, z. B. Dahabi, Tadkirat al-huffäz, n 275, 12. 

*Ag.ixll6,6. 

5 Der seltene Frauenname üb kommt in der Form bb vor in dem Sprich- 
wort bei Bürckhardt, Arabic Proverbs nr. 146 Uli. C^vftbo bb * UVä. .. *-o wo 



die Form durch das Homoioteleuton gesichert ist. 



, 6 Ag. xvii 12, 21 ff. 



.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Bemerkungen zur arabischen Trauerpoesie. 327 

Erst später, als solche alte Bräuche mit islamischen Anschauun- 
gen ausgesöhnt wurden, 1 hat man die Uebung derselben für den 
Freitag bestimmt, 2 wie sich denn auch in der definitiven Form des 
•\jaU ls*)^, der anfänglich die Opposition der Sunna-Leute hervor- 
gerufen hatte, ein Compromiss muhammedanischer Anschauungen 
mit alten Bräuchen darstellt Darüber gedenken wir bei anderer 
Gelegenheit ausführlicher zu reden. 



IV. 

Die arabischen Kritiker haben einen sehr eingreifenden for- 
malen Unterschied zwischen der Martija und allen anderen Gattungen 
der arabischen tSi'r-Dichtung beobachtet. Während die Kasida in 
allen ihren inhaltlichen Varietäten die constante Eigenfchümlichkeit 
aufweist, dass sie stets vom Nasib ausgeht, entbehrt das Trauer- 
gedicht, dem Anlasse entsprechend, dem es seine Entstehung ver- 
dankt, dieser für das Kunstgedicht charakteristischen, man kann 
sagen, unentbehrlichen Einleitung. 

Wenn der Verfasser des Trauergedichtes nicht frischweg auf 
den Gegenstand der Klage eingeht, sondern sich erst durch eine 
Einleitung auf diese vorbereitet, sind es in der Regel wenige typische 



ti öi 






u 

«4- ~° 



W I 

fN «/) 

f\l ^ 

, O) 

"sf U 

° J^ 

1 Einen merkwürdigen Typus für die Methode solcher Aussöhnung durch exe- 

O o 

getische Kunststücke bietet eben die Wendung, die man dem Hadit gab, in welchem 

,das Weinen um den Todten 4 verpönt wird. d^Ss. ^JLa\ *\iLo < »J^jo 'J*-£qM ^\ : 

,Fürwahr, der Todte wird (im Grabe) gepeinigt wegen der Wehklage seiner An- 
gehörigen*. Die Fortdauer der Todtenklage im Brauche der Muhammedaner nöthigte 

nun die Theologen, der 'Ajisa eine Interpretation dieses Prophetenwortes anzudichten, 

F ö. 



nach welcher der Prophet jenen Ausspruch bei Gelegenheit der Todtenklage um 
eine Jüdin gethan habe; derselbe habe demnach gar nicht allgemeine principielle 
Bedeutung: ^JLä\ fi l£o ^vX*f> oJL*J\ J^\ ^-c ^-ai-o dJU ~+* ^>\ ^^ L« . . . 
dJlH Ay**s \* <^j ^£> wOwXi.\ J^=Lb f,Jb^ <4öb A*±& ÜL*ioU CXojU doJi* 

^Xjü Ljili [+*!* o^. r*- 31 J^* ^^ W^ u^. *i?**i. J^ r*^* 
C~L« JS «JL* U>U f£L\ ^> 3 -ISLJJ J^Iä^ v-dj^d» J^t ^ U»^ ^i bei 



Sah Weli Allah al-Dihlawi: al-Insäi fi bajän sabab al-ichtiläf (Bombay, lith., 1303) 4. 



* Muh. Stud. i 247. 



W LT) 

.£ -o 
-ö v 

E-e 

E => 

ro <V 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 



ü Q_ 



Original fronn 



TD 






<=> o 



(T3 



= 1 

F P. 



328 Ignaz Goldziher. 

Formeln, deren er sich zu bedienen pflegt; zumeist die Schilderung der 
heissen Thränen der durch Weinen und schlaflose Nächte ruinirten 
Augen (mit dem typischeu ^5^); zuweilen die Zurückweisung der 
Tadlerinnen ( f awädil)/ die sein endloses Jammern nicht richtig 
finden; seltener sind an dieser Stelle selbsttröstende Betrachtungen 
über die Vergänglichkeit alles Irdischen. 2 Hingegen wird die Be- 
schäftigung mit Tändeleien geradezu abgelehnt. Man hat zwar die 
Schilderung der Atläl auch in dieser Art der Dichtung anzubringen 
versucht, 3 aber in engem Zusammenhang mit dem Gegenstand der 
Trauer gehalten. 4 

Als Specimen für die ausdrückliche Ablehnung des Nasib 
als Einleitung der Trauergedichte möchte ich hinweisen auf das 
Trauergedicht des 'Ubejdalläh b. Kajs al-Rukajjät über die 
in der Schlacht von Harra gefallenen Angehörigen seines Stammes, 
deren Tod ihm sein Vetter Jezid b. 'Ali b. 'Ubejdalläh in einem 
Briefe (vgl. v. 7) berichtete (Diwan nr. 40). 5 Es ist nicht unwahr- 
scheinlich, dass der Dichter durch den Reim (<&—) dieses Trauer- 
gedichtes die Reminiscenz der Todtenklage erwecken wollte. 6 



1 Dafür gebe ich im Anhang dieser Abhandlung (vi) ein Gedicht des 
Hudejliten Abu Du'ejb, welches auch als Specimen dafür gelten kann, dass der 
Dichter über den Ruhm der Betrauerten in v. 3 hinwegkommt und den Inhalt der 
Martija mit der Schilderung der Begräbniss- und Trauergebräuche erschöpft. — 
Die Anrede an die 'Awädil wird zuweilen an das Ende des Gedichtes gesetzt; dafür 
ist ein gutes Beispiel das Trauergedicht des Ibn al-Garira al-Nahsali; am Schlüsse 
desselben (Ag. x 98, 2 — 4) werden in drei Verszeilen die Vorwürfe der ,beiden 
Tadlerinnen 4 abgelehnt: ^JbjUl. 

2 Abu Zejd, Nawädir 36, Wbight, Opuscula 118 ult. Sawair 132. 
8 £awä c ir 6. 
4 Ibn Hisam, 1022, 5, Martija des Hassan über den Propheten; desgleichen 

beginnt Temim b. Mukbil sein Trauergedicht über f Otmän, aus dem einige Zeilen 
in dem unten folgenden Text des Ibn Rasik mitgetheilt sind, mit Atläl-Erinnerungen, 



u 

Jäktit m 398, 20 ff. 

5 Jetzt, ,Der Diwan des 'Ubaid-Alläh ibn Kais ar-Rukajjät', ed. N. Rhodo- 

> <u 

C CT 
=> O 

— o 

CO 



kanakis (Wien 1902) 186. — In v. 1 hat meine Abschrift für das <CxX* C^S+3+ 
der Ed. Rhodokanakis: ^XJU* (in der Bedeutung: JCsvo). — Zu v. 9 vgl. Näb. 
(Ahlwardt) 17, 14. 

«+10) 

6 Vgl. denselben Reim in einem kurzen Hezeg-Trauergedicht, Ag. xx 102, 
in w 

17 — 21, im Trauergedicht der Hind über die Bedrgefallenen, Ibn Hisäm 537, 7 — 13. 

11 

E => 

fD O) 



Original fronn 



£ CO >"» I 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Bemerkungen zur arabischen Trauerpoesie. 329 

Nur das Trauergedicht des Durejd b. al-§imma über seinen er- 
mordeten Bruder wird als Ausnahme erwähnt; es beginnt mit Liebes- 
schilderungen. Aber dies Gedicht wurde ein Jahr nach dem Tod 
des Betrauerten verfasst, als bereits auch die Blutrache für ihn er- 
füllt war. Darin findet man die psychologische Rechtfertigung dafür, 
dass Durejd die Trauer um den Bruder mit dem Ausdruck anderer 
Gefühle vermengen konnte. In der That wird dies Gedicht in der 
Gamhara, in die es aufgenommen ist, unter den Muntakajät, nicht 
aber unter den Maräti vorgeführt. 1 Freilich fehlen in der Gamhara- 
Recension des Gedichtes, bei ihrer Vergleichung mit einer anderen 
Ueberlieferung desselben, 2 zwei mit ^^JiW resp. mit J5^l beginnende 
Zeilen, die dem Gedicht erst recht den Charakter einer Martija zu 
verleihen geeignet sind. 

Der , ungeschlachte' Temim b. Ubejj ibn Mukbil geht sogar 
mit der in den Kasiden beliebten Formel: ,Aber lass' dies' von 
der Trauer um 'Otman b. 'Affän auf die Schilderung der fort- 
ziehenden Geliebten über, ,die er wegen der Erschlagenen von Kurejs 
nicht vergessen mag'. Dies eine Beispiel kann uns zeigen, wie 
wenig echtes Gefühl zuweilen der im Trauergedicht zur Schau ge- 
tragenen Verzweiflung entspricht. Als dritte Varietät könnte diesen 
beiden Specimina übrigens ein Beispiel angereiht werden, wo in 
einem kleinen Regez-Trauerlied die Beziehung auf Wein, Weiber 
und Gesang inmitten der Todtenklage eingeschoben ist. 3 

Ueber diese Eigenthümlichkeit der Martija spricht sich der 
berühmte Poetiker Ibn Rasik aus in seinem Buch al-'Umda fi 
mahäsin al-Si f r. Ich gebe das betreffende Stück nach der Hand- 
schrift der Leipziger Universitätsbibliothek, DC. nr. 328, fol. 165 b : 



"O 



V öl 



w I 

fN CO 

, O) 

° m 



o o 

c v> 
o E 



F P- 






> <u 

1 Gamhara 117. 2 Ag. ix 4, 23-24. 

3 Lebid (ed. Hüber-Brockelmann) Fragm. nr. 12 allerdings nur in der Ueber- 
setzung (VV. 6 — 9); im entsprechenden arabischen Texte scheinen die VV. 7. 8 
ausgefallen zu sein. 

II 

E => 

fD O) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



TD 



ö. ^ 
.c o 



w I 

fN CO 

, O) 

O u 









3 O 



330 Ignaz Goldziher. 

<k^rL\ JJü* Jesu Joo JI^ä^ W^ ^^°-^^ ^UJüb^Jl^ äLu-il ^yc dc^s yb U~> 
JI>ä*\ l-a-o^ JLr*^. ^^ ^^ e?* >* 2 ^ o* ^ Ju *-^ ) wxS^ ^ c^ ^Lr^ ^ 

i_öy JJCaM^ ^^^ ^->Vä-S) ^Js.ä.^J <5-&^ l)-^ ^*^ C^3 ^ £A* 

vlyü ,j«^Ül 0>l* ^^ J^" USUt «of^S JuS <>~i3 <J_, 

w *ji *il»*N v^f Jj \>\ l ;-«ll 13 JA^i oö^ ^Ak 

B <*_^> >jsj ^^oI^äJ ioJ^+s \ ^uux> ^j> o' sX ^f S-*^"^ er 

ji^Jb ^SL»t ii^l o>^ O^ ^1 i^U>oJ\ ^ ^^>Jjo ^jJLp v^äU.1 



Die Maräti- Gedichte waren in der arabischen Philologie vom 
Anbeginn ein bevorzugter Gegenstand der Ueberlieferung und 



o o — 

1 Cod. £j>,\. 



2 Nun folgen noch mehrere Zeilen dieses auch sonsther bekannten Gedichtes. 

3 z. B. in dem Trauergedicht auf Chandak Ag. xi 47 unten; dieselbe Methode 
übt er auch in den Häsimijjät ibid. xv 124, 25 ff. 

4 Cod. Lio £ iJLXä- Mit unserer Emendation stimmt auch (nach Mittheilung 
des Herrn Professor B. Moritz) die Handschr. der vicekönigl. Bibliothek in Kairo, 
Adab, nr. 456. 

5 Zu dieser Verszeile giebt der Kairiner Gelehrte, al-Sejjid Muhammed 
al-Bibläwi folgenden Commentar (briefliche Mittheilung): J^jJ^sue ^ß\ 4iLub *\yc\ 



ö^* ^3 u^/^ £*r uP^-^- 



6 Cod. Ua^L. 

=5 Ä 



E c 

E => 

fD O) 

1 S Digilized by L^OOglC CORNELL UNIVERSITY 

— 

ü Q_ 



Original from 



Bemerkungen zur arabischen Trauerpoesie. 331 

Sammlung. Die Omajjaden, die mit grossem nationalen Eifer die 
Aufbewahrung der Producte der alten Poesie förderten/ gaben sich, 
wie al-Gähiz 2 und Abu 'Ubejda 3 berichten, vorzüglich mit Ueber- 
lieferern ab, die auf die Aufbewahrung der Maräti Gewicht legten; 
sie motiviren diese Gesinnung damit, dass aus solchen Gedichten die 
edeln Eigenschaften der arabischen Vorfahren am besten ersichtlich 
werden. Solche Gedichte boten sich daher den Sammlern der spä- 
teren Zeit als Gegenstände specieller Anthologien dar. Eine jetzt 
— wie es scheint — nicht mehr vorhandene Maräti-Sammlung stellte 
zusammen ein Mitglied der in der 'Abbasidenzeit berühmten Gelehrten- 
familie der Jezidi, 4 Muhammad b. al- f Abbäs (st. 3 10), Erzieher des 
Chalifen al-Muktadir. 5 Er war Enkel des unter Harun al-raäid und 

m 

Ma'mün berühmten Dichters und Schöngeistes Abu Muhammed Jahjä, 
und gehört dadurch der Familie des Dichters Du-1-rumma an. Muham- 
med b. al-'Abbäs al-Jezidi ist Verfasser mehrerer poetischer und philo- 
logischer Schriften, 6 deren Inhalt sich sowohl auf Nachrichten aus dem 
arabischen Alterthum als auch auf solche aus neueren Zeiten bis auf 

TD 

die des Chalifen Ma'mün erstreckt. 7 Er hat mit Vorliebe Dichter- 
nachrichten gesammelt und ist in dieser Beziehung eine ergiebige 
unmittelbare Quelle für den Verfasser der Agäni, 8 sowie für Abu 

Q. 






O o 



(T3 



1 Vgl. JRAS. 1897, 326 ff. 

2 Bajän ii 36: \ 3t i^J\ J^Ju ^ £U\ ^ CUil* ^-^it ^\ JUS 
J^\ ?J 15^ ^ JjJ ^K) J^S ^\> £, J*ä JXj+Ü Ztfj 05 £j>. 

8 al-Bejhaki, Mahäsin ed. Schwally 373, 10. 

4 Vgl. Mittheilungen über diese Familie Ag. xvm 72—87. 

5 Fihrist 51, 15. 

6 Ag. x 31, 5 v. u. ist sein JaSULÜl ^U5, xv 3, 6 sein ^b\yL\ ^U^ 
citirt. Die Nachrichten über sein Leben und seine Schriften sind von G. H. Engel- 
mann in der Einleitung zu seiner Ausgabe : At-Hadirae Diwanus cum Jezidii Scholiis 
(Leiden 1858) 3 ff. zusammengestellt. Der Diwan verdankt seine Redaktion und 
die erklärenden Scholien eben diesem Muh. b. al-\Abbäs. 

«4- ~& 

7 Die 'Abbäsidennachrichten hat Süli fleissig benutzt; ein Citat nach Süli 
bei Sujüti, TaVich al-chulafä (Kairo 1305) 128, 11 v. u. 

8 Einige Beispiele, aus deren Inhalt man auf den weiten Zeitumfang der 
Nachrichten schliessen kann: Ag. iv 156; 157; 161,6; 176,19; 182penult; vm27, 5; 
166, 16; ix 37 unten; 171,17; xi 171,15; xn 14,12; 44,11; xm 99, 4 u. xx 147,10; 

xxi 112, 3. - 0\ j^js? v_jUS cy o C^s^ xi £8, 16; 91, 13. 



2 75 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



332 Ignaz Goldziher. 

'Ubejdalläh al-Marzubäni (st. 378), einen der reichsten Tra- 
denten von Nachrichten über alte Poeten. 1 Er ist der bei ersterem 
einfach unter seiner Nisba al-Jezidi angeführte Ueberlieferer 2 und 
es ist wahrscheinlich, dass die Berufungen auf ihn bei Gelegenheit 
der Mittheilung von Trauergedichten und der einleitenden Erzählungen 
über die den Todesfällen der beklagten Helden vorangehenden Er- 
eignisse 3 aus seinem Specialwerke über Maräti entnommen sind. 
Der Verfasser der Chizänat al-adab, dem auch sonst viele jetzt ganz 
verschollene litterarische Alterthümer noch zur Verfügung standen, 
hat auch dies Werk des Muhammed b. al-'Abbäs al-Jezidi in einer 
sehr alten Handschrift vom Jahre 368 benutzt. 4 

Der Beliebtheit der Maräti- Gedichte ist es wohl zu verdanken, 
dass wir dieselben noch heute in so reichlicher Anzahl besitzen. 
Sie zeigen auch in ihrer künstlichen Ausbildung eine Menge popu- 
lärer Elemente, und sind dem allgemeinen Verständniss leichter zu- 
gänglich als die schwerfälligen Kasiden der anderen Gattungen. 
Ueberdies hängen sie unter allen Arten der klassischen Poesie am 
meisten mit volkstümlichen Uebungen (Todtenklage) zusammen. 

Aber durch die formelhaften Elemente, die dieser Dichtungs- 
gattung eigen sind, konnte sie auch mit der Zeit leicht den ern- 
sten Eindruck einbüssen, auf dessen Hervorrufung sie angelegt ist. 

in ^ 

Wenn der medinensische Dichter f Urwa b. Udejna sein Trauergedicht 
über seinen Bruder Bekr als dichterisches Kunststück recitirt, so hat 

£ E 1 

O o 

1 Von Marzubäni citirt sehr oft sein Schüler 'Ali al-Murta<Jä (355—436) im 
Gurar al-fawä'id; 202: ^j^j^\ ^^oCLaH ^ j^js^ U^oLl JIS J^bj^-Jl U^Ü^ 
U^ä3\ ^\ US'Ja. JIS, oder 298: jJ^sT ^Ju'Iä. J15 (Jibj^Jl) AÜl j^x U^J 
^IIaJI ^\ u. a. m. 

2 z. B. Ag. ix 131, 3; x 5, 24; 6, 20; 79, 6; xi 53, 11; xn 44, 9 v. u. xvm 
128, 13. — c Ubejd alläh b. Muhammed al-Jezidi. Ag. x 88, 14; xvi 86, 12 ist sein 
Onkel, vgl. «UJl J^c ^^U ^^OwXä. xviii 73, 17; 83, 4 v. u. und öfters. 

3 Ich rechne hieher die Nachrichten Ag. xn 15; ix 7 unten; xi 8, 7 v. u.; 46, 3; 
47, 23; xxi 265. 268. 






(T3 



2 5 



F P. 



u 

3 



> <U 

c CT - • 

4 Chiz. ad. in 655: j^^ l^*^. jj>^ «^i'lj-Jl ^ ;UA-t jJUaÄJl ^ ^yt^ 

£ -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



ül^iü^ < 2X^ A * J ^ o^ ***•**> <*i=^ <L>^ v3j^^ 



Original fronn 



Bemerkungen zur arabischen Trauerpoesie. 333 

der Schlussvers dieser Dichtung: /Und wie könnte ein Leben nach 
dem Tode Bekrs noch Annehmlichkeiten bringen?' — eine ab- 
gegriffene Formel dieser Poesie — zum grossen Aerger des Dichters 
den in pietätloser Form laut werdenden Humor der Hörer hervor- 
gerufen. 1 

Auch die Uebertreibung, welche in der Herzählung der ,rühm- 
lichen Eigenschaften' vorherrscht, hat nicht verfehlt, häutig auch den 
Spott des Publicums herauszufordern. 

,Jede Klage fr au lügt, mit Ausnahme der Frau, die über 
Sa f d b. Mu'äd die Todtenklage gesungen' 2 — so lässt man den 
Propheten das Gemeingefühl ausdrücken. Daran war ja auch zum 
Theil die Maasslosigkeit schuld, die im Betrieb des Trauergedichts 
von alters her Platz gegriffen hatte. Der Ausdruck der Untröstlich- 
keit gehört zu den Erfordernissen dieser Poesie. Als Typus der 
Zurückweisung jeder Tröstung wird ein Vers des 'Antara (weder im 
Diwan noch im App. ed. Ahlwardt vorhanden) angeführt. 3 Die 
Trauer um den Verstorbenen wird ewig andauern; fortan hat die 
klagende Person auch für anderes Leid keine Thränen mehr, sie 
werden — und dies wird mit einem Schwur bekräftigt — nur für 
den Gegenstand der gegenwärtigen Klage strömen. 4 Eine ganz eigen- 
tümliche Pointe gewinnt dies Gelübde, wenn es eine Frau ist, die 
ihr Klaglied mit dem Versprechen ewiger, niemals aufhörender 
Trauer um den beklagten Gatten schliesst. 5 Sie wolle mit ihrer 
Trauer der Turteltaube (cär**) gleichen, die den Tod des Männchens 
in lebenslänglicher Einsamkeit beklagt. 6 Die in ihren Liedern solche 
verzweiflungsvolle Trauer gelobten, sah man aber nicht selten recht 
bald bei dem Hochzeitsfest an der Seite des zweiten oder eines 
weiterfolgenden Gatten. Die Litteratur hat sich besonders an einem 



ti öi 



O) 

^ u 

O o 

c v> 
o E 



ru 



U 

«4- ~° 

1 Ag. vi 131; xxi 171. 

* Ibn Hisäm 699, Usd al-gaba n 298: A*>\S (£ä>U) 2o>ü A*- 



3 Zahr al-ädäb ('Ikd. 1 ) in 245 ^^b JJLjo cr c ^ yo\. 



> <u 

B ° 

4 Ibn Hisam 529, 13. 

5 Lejlft, Ag. x 78, 6, Chansä 40, 8 ff; 90, 6; Sawft'ir i 131, 2. 

6 Kazwini ed. Wüstenfeld i 423; Darairi s. v. n 305, 9. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



334 Ignaz Goldziher. 

solchen Fall belustigt, der auch in der That die bösen Zungen der 
vornehmen Gesellschaft in Medina zur Frühzeit des Islam beschäftigt 
hat. Die Ansär-Frau c Atika bint Zejd verlor ihren Gatten, 'Abdallah 
Sohn des Chalifen Abu Bekr, in der Schlacht bei Ta if. Sie wid- 
mete ihm ein ergreifendes Trauerlied mit folgendem Schluss: 

,Ich schwöre, mein Auge soll nicht aufhören deinetwegen von Thränen 
heiss zu sein und mein Körper soll immerfort in Asche gehüllt bleiben, 

Ewig und immerdar, solange nur die Turteltaube auf den Wipfeln girrt 
und solange die Nacht dem hellen Tage folgt.* 1 

00 

o 

1^ 

Als sie bald hernach (einige sagen sogar: in dritter Ehe) ihre 
Hand dem Chalifen 'Omar schenkte, der zu Ehren seiner jungen 
Gemahlin ein grosses Gastmahl veranstaltete, rief 'Ali ins Frauen- 
gemach die Klageworte der 'Ätika hinein, erinnerte sie an die ,lebens- 
länglichen heissen Thränen' und den ^staubbedeckten Körper' und 
schloss mit den Koranworten (61, 2. 3): ,0, ihr Gläubige, warum 
sprechet ihr, was ihr nicht erfüllet; gar sehr hasst es Allah, dass 
ihr sprechet, was ihr nicht erfüllet/ 2 Die polemische Spitze dieser 
Erzählung ist wohl gegen die vom Islam vergeblich und erfolglos 
verpönte Todtenklage gerichtet. 

Diese Absicht ist bei den philologischen Anekdoten, welche 
die Tendenz verrathen, die Aufrichtigkeit und die Ernstlichkeit der 
übertreibenden Todtenklagen der Frauen ins Lächerliche zu ziehen, 3 
ausgeschlossen. Von diesen Anekdoten, wollen wir als Probe hier 
eine auf al-Asma'i zurückgeführte hervorheben, die nach Ibn Durejd 
dessen Schüler Abu 'Ali al-Käli mittheilt. Auf einer seiner Forschungs- 
ausflüge in die arabische Wüste — erzählt al-Asma'i selbst — zog 
er an einem Grabe vorüber, bei dem er eine Frau die folgenden 
Klageverse jammern hörte: 



w i 

fN CO 

O u 



o o 

c v> 
o E 



(T3 



2 5 



F P. 



u 

«4- ~° 

O <L> 

'i/i öi 

> <U 

=) O 



1 Anis al-gulasä nr. 37 (164, 1). 

2 Ag. xvi 134, Chiz. ad. iv 351, Usd al-gäba v 498. 

3 Man vergleiche besonders die frivole Anekdote des Abu Tumäma bei Pseudo- 
Gähiz, Mahäsin ed. van Vloten, 357, 3. Einem humoristischen Zweck dient die 
altertümliche Sag'-Klage, Mejd. n 137 zum Sprichwort JxaJ Lir* "J. 

.E "ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frarn 

| S Digmzeo Dy ^uu^ll CORNELL UNIVERSITY 

ü Q_ 



0} 






o o 

c w 
o 5 



(T3 



F P. 



u 

O <L> 
'i/i öi 



Bemerkungen zur arabischen Trauerpoesie. 335 

,Wer wird nunmehr Bitten gewähren, wer Gaben spenden ; wer unser 

Sprecher und Redner sein! 
Wer unseren Vertheidigern und Kriegshelden vorstehen, wenn alle Krieger 

knieend niederhocken! — 
Wenn man sagt : Gestorben ist Abu Mälik, der Mann der Edelthaten, der 

auserwählte Fürst der Araber?* 

Mitfühlend neigte sich al-Asma'i zu der wehklagenden Frau und 
fragte sie, wer denn jener betrauerte Mann war, dessen Tod eine 
so klaffende Lücke zurückgelassen. Als die weinende Frau zu ihm 
aufblickte, gewahrte er ein ausgedörrtes, buntscheckiges, zahnloses 
Weib, das ihm folgendes antwortete: ,Möge ich die Lösung für dich 
sein! Dieser hier war Abu Mälik der Schröpfmeister, Schwiegersohn 
von Abu Mansür dem Weber/ 1 ,Möge dich Gott verfluchen — ver- 
setzte hierauf al-Asma'i — ,ich hätte geglaubt, du beweinst einen 
Fürsten von den Fürsten der Araber/ 2 

Denselben Zweck, den al-Asma c i mit dieser etwas derben Er- 
zählung verfolgte, beabsichtigen auch einige in die Biographie der 
Lejlä al-Achjalijja hineingedichtete Daten über ihre Unterredungen 
mit omajjadischen Chalifen. 8 Man erzählt z. B., dass Mu'äwija sie 
gefragt habe, ob es denn wirklich wahr sei, dass der in ihren 



1 Die beiden verachtetsten Berufsklassen, Globus, lxvi (1894) 204. 

2 Amäli al-Käli (Handschr. der Biblioth. nationale nr. 1935), fol. 17 ft = al- 
Nuwejri (Leidener Handschr. nr. 2 b ), fol. 129: U-^\ JU> (j^ mJ > Cr >) ^o ^>\ UjjLä. 

J^aj^ c^ - ^ J^* ^^ *\j*\ <^?\j* ^i^^^i O^S 

■Z j. f t, 

cu3LÄi *$y+± W-^ <3^ '^y*> OU v3»3J\ IvXä ^J< cuJuü L^^J\ cuJl».* JU 

v^JU *JUiÄ5 eXS^i-\ j^a-U> ^\ £y£±* f«^ viX)^o >>\ ^wXA s**-Xj>s>3 CUJüü 



o 

8 Ag. x 79, 8; 81 penult. 84, 17 (Begegnung mit Haggäg) sind die Dinge 
schwächer aufgetragen. 

11 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



336 Ignaz Goldziher. 

Klagliedern als ganz besonderer Tugendheld gepriesene Tauba 
eigentlich ein schändlicher Kerl gewesen sei. Der Chalife Merwän 
wieder fragt sie, ob es sich bestätige, dass derselbe Tauba, dessen 
Ritterlichkeit in ihren Liedern so oft wiederkehrt, nichts anderes als 
ein gewöhnlicher Raufbold und Kameldieb war. Sie weist diese 
Beschuldigungen natürlich als ganz gemeine Verläumdungen zurück. 1 

VI. 

Anhang. 

(S. oben Seite 328, Aura. 1.) 

Aus dem Diwan des Abu Du'ejb al-Hudali (Handschr. Landberg, 

fol. 145* ff.). 

^_s\^ Uli J>\ jud, ^j * rfju J>\ jlc *pi ii Jiui 
s> \\y>)\ ^ 3 ^J*L\ ÄJJU* * \ Jb\j5 ^u^o! p-^süi ü*i 

wX^u*> ^ft \J5 y ^y^jwwwol ,>j^ * A ***Jo JjJ^p »Lop \y^ 5 

<**^ o^P l > .J^ ^&*s * rd**^. «-A-*** & cÄ 

± e\>iil .WK ULLi lldS * \ 3 ü'lsi (^i.V}i l^Jliji jJJ^ 

^5 j^Uo o^^ ^^t ^^r*^ * v^JuiJS UJ yuJl oy; cx&» 





T3 



03 



fU 



10 



u 

O <L> 

Anmerkungen 

> <u 

3 O 

— O 

c O 

ft3 



1. LA. \}j i 79. — Schol. Var. J^^. Derselbe Anfang in Trauer- 
gedichten häufig, z. B. Zuh. 2, 1. Der erste Hv. fast wörtlich, 



1 al-Husri, Zahr al-ädäb 1 , in 249. 250. 

T3 £ 

E => 

fD 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 






w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o 5 



(T3 



$ 5 



F P. 



u 

«4- "° 

O <L> 

■h! ■— 

'i/i öi 

> <U 

3 O 



Bemerkungen zur arabischen Trauerpoesie. 337 

nur mit anderen Eigennamen am Anfang des Trauergedichtes 
des Durejd b. al-§imma über den Tod seines Bruders, c Ikd. in 
75, 16; Ag. ix 4, 24, wo noch eine Zeile vorhergeht; vgl. Huf. 
28, 5. 6. Wright, Opusc. arab. 108, 5. Einer der Wehrufe in 
der Todtenklage ist auch *^.}j *> S. im Trauergedicht des 
Kajs al-ruk:ajjät xl v. 13 und vgl. Mas'üdi ed. de Goeje 
287, 10. 

2. LA. e^oi i 370. — Schol. ^ ^jJ* ^i J^ ; ^\ \S \>\ ^*+*ati\ J15 
cy *J\ i*^ y£ UJUkJl Cj>j\ \>\*> cr ~~3\ Üw^. — Näb. 3, 9. 

3. LA. wxij iv 179. — Schol. *~~?« ^ ^ ^Aj *S\S U^-U ^ JS ^\. 

5. LA. JJj xm 327. ^io JjJjX 

6. LA. j~+*. v 261. — Vgl. Muh. Stud. i 244, Anm. 1. Nöldeke, Beitr. 
179 v. 5, Jacob, Beduinenleben 140, 2. 

7. Schol. Jl^Jl <^ <-*** L^b^. ^Ä **-■** iJt ^*>. e>V^ 1 u^* 

8. LA. t^i ix 243, J-*\ xm 9. — Ibn Walläd ed. Broenle 61, 5; 
Schol. OJJtX \3\ i-Al J^ -UJl* AjU^-Älj ^JUl ^\y <*~U*o Jyb 
iJLA+h* <LsOj.Z* Jsjüu aJsU^ lfc J- % jBJÜ SjiyC*«*-*. 

9. LA. wXa^ iv 464; ein seichtes Grab, das nicht tief wie eine Ci- 
sterne gegraben wird; Beschreibung des Grabes, Diwan Hätim 
ed. Schulthess 19, 9. — Schol. ^> ^ j^aJ^J U\ ^-^-oj' <^l l$-> o** 3 ^. 

11. LA. 1-r &*. viii 162; <^5 xi 9. Die Enge des Grabes wird oft hervor- 
gehoben; z. B. Mälik b. al-Rejb (in einer I£aside, der viele 
Daten über Begräbnissgebräuche zu entnehmen sind): ,Möget 
ihr mir nicht missgönnen ein Stück von der weiten Erde, dass 
ihr mir (mein Grab) weit inachen möget;' Gamhara 144 v. 8. 

12. LA. J-~o xm 56 (ibid. J^, iv 474 mit der La. JUL&y Q). Zu 
dem Gleichniss mit dem Schöpfeimer und der Tränke, s. , Ab- 
handlungen zur arabischen Philologie' 11 xxx, Anm. 3; Schulthess, 
zum Diwan tfätim 48, v. 2 (S. 50). 

Ausser der gewöhnlichen Benennung ^2^ (die jedoch auch 
für sonstige Kleidung gebraucht wird, Imrlk. 65, 6), woher ^Ü, 
in das Leichentuch einwickeln (Mutammim, Nöldeke, Beitr. 79, 



£ -o 

E-e 

E => 

fD 0) 

1 S Digilized by L^OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



ti öi 



(T3 



2 5 



F P. 



u 



338 Ignaz Goldziher. 

v. 2. Ag. xiv, 70, 4) dient in der alten Sprache zur Bezeichnung 
derselben Sache auch das Wort <*^4j; der Todte ist die Füllung 
der r. 



i&j >^i,i \ j^ 3 * ^L^i ^° ^ f^J\ ^jj f$ 



'Adi b. Zejd, Chiz. ad. i 183 ult. >^j SJlajj j-äa. ^y \ 3> \ 
Adab al-kätib ed. Grönekt 432 ult. (= Kairo 141, 14), 'Ajni n 
193 (sowie man den Helden &> y&^» Zuh. 2, 3; 4, 7 Aus b. 
Hagar 33, 2, Kämil 268, 21; 761, 15, den Todten auch Uxs*. 
«J^4* Hätim ed. Schulthess 25, 12, Lebid, App. 13, 1 nennt; 
vgl. Abu Temmäm, Diwan 348, 11). — Endlich heisst das 
Todtengewand auch ^-yy^ 'Ant. 25, 6. Der in seinem Blute 
liegende Held hat gleichsam Leichenkleider aus Purpur <^oL^*j 
O^-j^ Ham. 377 v. 1. — Im Islam wird die Todtenkleidung 
als aus zwei Stücken bestehend bezeichnet 

Anonymus bei Murta(Jä al-Zabidi, Ithäf al-säda (Commentar 
zum Ibjä des Gazäli, ed. Kairo) x 234. Der Genosse Täbit b. 
Kajs b. Sammäs am Schlachttage von Jemäma: o~^ ^^ ^ 
U-^a cr^4. err**^ £?&>> Ihn Sa'd, bei Murta<Jä 1. c. 331, 4 v. u. 
Andere Ueberlieferungen über die Zahl des Kafan hat Mas'üdi, 
Tanbih ed. de Goeje 281 unten. Vgl. auch Hschr. Berlin, Ahlw. 



™ iß 

nr. 5452 

O o 

c ^ 
o E 



s>^3- Die Lage, die in solchen Beschreibungen dem Todten 
gegeben wird, entspricht der Schilderung der Lage während 
des Schlafes, Ag. vn 112, 17. Ä-^.y (a^-*-*^) ^^ ^ *J^> j^o^i 
vgl. Hut. 7, 18. Musnad Ahmed iv 281: £>\ AJ \>\ *Ü\ Jy^j cJ 6 
J\ Jyo^ <*^^. a-iy fl-o = ibid. 298, 4 ^^-«-^ *w>o ^ *J>^. 5^, 
300, 15 **>>*. iS^x* ^5-U-Jl *wX£ 5*0^. Beim Begräbniss legte man dem 
Kopf des Todten den rechten Arm unter, Ag. x 113, 3 e^^-L^ jS f 

^z*i 9 vgl. Abu Temmäm Diwan 349, 3 v. u. \^y« L j~~o\ 

^^> *3j-^ ^i; in einer islamischen Schilderung (vom Leichnam 
des Auzä'i) J--JJx%w-< yt^ SwXsL C^s^ ^^^\ *jo g^o^ v>£ ^y° *^^>* 
Ä1-JU\ Dam. s. v. r^ 1 171. Von Leuten, die kein ordentliches 



<u , 
> cu 

C CT 
=) O 

— O 

CO 

w tn 

£ -o 
-0 v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original fronn 



TD 






w i 

fN CO 

f\l ^ 

, O) 

O o 

c w 

o 5 



F P. 



u 

O <L> 

■h! ■— 

'i/i öi 

> <U 

3 O 

— O 



Bemerkungen zur arabischen Trauerpoesie. 339 

Begräbniss erhalten Ia^j^L j^*)p % <J (oder ^j^jsJ) c^* A'Sa 
Bekr, Ikd. m 116, 13, Kämil 638, 9. Daher wird dann ^3 
im allgemeinen ohne nähere Bestimmung von der anständigen 
Beerdigung überhaupt angewandt: ^x-i^ t^ ^ OXZ^ ^j\ C^j>^ 
ob ich nun gebettet (d. h. begraben) werde, oder unbegraben 
liegen bleibe, c Adi b. Zejd, Gamhara 103, 5 y^\ ^ w^y ^^w 
Al-Azralp 1 64 penult. Als Object kommen auch Staub und 
Steine vor: ^^^ ^y \^y* ^ ^ CU*^°\ l Ag. xxi 129, 13 
vgl. ibid. viii 5, 15. Ganz pleonastisch ist das dort völlig un- 
passende ^&, ^ (da doch der Todte eben im Grabe gebettet 
ward) wohl wegen des Reimes herbeigezogen in einem Trauer- 
gedicht des IJassän auf den Propheten, Ibn Hiääm 1022 ult. 
(fehlt im Diwan). 
13. Schol. v^hübj ^ JiUl '^jfj. Damit wäre der Anruf der Tad- 
lerinnen am Schlüsse wiederholt. 



Wiener Zeitscbr. f. d. Kunde d. Morgenl. XVI. Bd. 23 

o c 

E => 

fD 0) 

1 S Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original frorn 



T3 






Critical Remarks on the Text of the Divyävadana. 

By 
J. S. Speyer. 

(Continued.) * 

XXII (Candraprabhabodhisattvacaryävadäna). 

LXVII. P. 315, 8. I read suvibhaktä, and 1. 18 I propose to 
constitute the long Compound adjective thus: utpalapadmakumuda- 
pundarikädisurabhijalakusumaparimanditä 'tisvädu ] "ti for ni has 
been already conjectured by the editors. 

LXVIII. P. 321 , 9 foll. — The r§i Visvämitra, a pancäbhijiia, 
understanding the meaning of the portentous signs that appear in 
the sky, has a presentiment of the approaching death of the holy 
king Candraprabha. This is first related in prose, then worked out 
in some elaborate atrophes, which in the printed text are not dis- 
tinctly denoted as such. For this reason I let them follow here in 
due arrangement and, as far as I could, corrected. The metre of 
stanza 1 and 2 is vasantatilaka, that of nr. 3 särdülavikricjita. 

tathä hi (extra versum) 
rodanti Kinnaraganä vanadevatä ca* 



w i 

fN tO 

f\l ^ 

, O) 

o y 

o 5 

c v> 

o E 



(T3 



= 1 

F P. 



u 



dhikkäram utsrjati devaganä *pi tasthuh* \ 

•o na bhäti na vibhäti sahasraraSmih 

khe vädyaväditaravo 'pi nisämyate y tra || (l) 



candro na bhäti na vibhati sahasraraSmih 



> <u 

C CT 

=> o 

— o 



1 See vol. xvi, p. 103 foll. 



si $ 2 Cp. p. 320, 27. 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

10 4J 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



CRITICAL ReMARKS ON THE TeXT OF THE DlVYAVADANA. 341 

ete hi pädapaganäh phalapuspanaddhä 

bhümau patanti pavanair api cälitä na | 
saniSrüyate dhvanir ayarrt ca yathä 'tibhlmo 

vyaktarrt bhavisyati pure vyasanant mahäntam || (2) 
ete Bhadraiiläniväsaniratäfy sarve saduhkhä janä 

atyantaprati&oka&alyavihatäh praspandakanthänanah, \ 
etäs candranibhänanä yuvatayo rodanti veSmottame 

sarve ca prarudanti tfvrakarunäs santafy imaiäne yathä\\(3) 

I have spaced the words I have tried to emend. Such gross 
faults as rodanti and mahäntam must be attributed to the author 
of this avadäna. As to the asteriscs put in päda b of stanza 1-, 
MSS have api tasthuh, which is forbidden by the metre. But after 
removing the supervacuous initial a, the whole second part of that 
päda remains obscure. What can be meant here, in the enumeration 
of ill omens, by the mentioning of the deities standing still? Would 
it be too audacious, supposing the corruption to lie a little deeper, 
to propose this correction: devagano y pi süSruh (the deity of the 
forest utters a cry of distress, and the crowd of gods pour tears)? 

In the sequel (p. 321, 26) the psi draws his conclusion in a 
sentence which is not prose but an anusjubh öloka. Correcting two 
errors, one in päda b (pravaräni) and one in d (ksemo), I read it thus : 

aäiväni nimittäni pravartante hi sämpratant 

ksemärp, diSam ato 'smäkam ito gantuni ksamarß bhavet. 

XiXIX. P. 324, 1. — King Candraprabha says to Raudräksa: 
'come and make me know your wish; whatever you ask, you may 
take/ The word yacchatäm is evidently corrupt; the editors, in a 
foot-note, propose ucyatäm. I prefer yäcyatäm, so that the whole 
passage runs thus: ehi tvarrt brähmana yäcyatäm yat prärthayase 



.c o 



w I 

, O) 
O u 



o o 

c v> 
o E 



(T3 



= 1 

F P. 



u 

O <L> 

N 



tad grhäneti. 

Some lines below Raudräksa puts forth his desire. He asks 



> <u 

3 O 

the king's head. He expresses his request in an elegantly turned 

I S 

ifl tn 
£ -o 
-ö v 

23* 

E => 

fD O) 

10 X-> 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



vasantatilaka, and the king, granting him his wish, uses partly prose, 
partly an upajäti strophe with one jagatl päda. As neither of those 



Original fronn 



342 J. S. Speyer. 

metrical portions is denoted as such in the printed text, and some 
corrections are necessary, I give them here in füll. 

1. vasantatilaka, pronounced by Raudräksa (p. 324, 4): 
dharme sthito J si vimale Subha bodhisattva 

sarvajnatäm abhilasan hfdayena sädho \ 
mahyam Sir ah Sfja mahäkarunägraceto 

mahyam dadasva mama tosakaro bhavädya \\ 

2. upajäti, spoken by the king (p. 324, 10): 
priyo yathä yadyapi caikaputrakas 

tathäpi me sirsam idam grhäna | 
tvaccintitänärri phalam astu Sighram 

Sirahpradänäd dhi labheya bodhim \\ 

That I change kharpam into Sirsam, rests on this reasoning. 
Kharpa is no word at all, and a possible hypothesis that the author 
of this avadäna — and a pitiful writer he is, indeed — might have 
fashioned it himself for kharparam, which did not suit the metre, 
would not be sufficiently founded, kharpara meaning 'sktdP, not 
f head\ Now, Sirsam = Sir ah is not uncommon, also in Buddhistic 
Sanskrit, and the dissyllable wanted here must be a trochaic word, 
meaning c head\ The characters that make up iffa and Wm are not 
so distant from one another in Nepalese handwriting. The other 
emendations do not want an explanation. 

LXX. At p. 334, 15 is quoted a saying of the Lord that there 
are five beings charming tQ. the eye, paficäsecanakä darsanena. If 
I see well, the very words of the Lord make up an anustubh, the 
third and fourth päda of which have been depravated in the tradition. 
Emending them, we get this äloka: 






■o 



.TD 






(T3 



2 5 






hastl nägaS ca räjä ca sägaraS ca Siloccayah 
darSanenäsecanakä BuddhaS ca jagatäw varah.. 



In päda a the accumulation of the words hastl nägah to denote 
'the elephant*, is somewhat stränge, for they must denote one being, 
if the verse is to demonstrate, as the prose text puts forth, that 



> <u 

c 

=) 

c (5 

CO 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CRITICAL REMARKS ON THE TEXT OP THE DlVYAVADANA. 343 

there are ßve of those charming beings. I deem it not improbable 
that the verse, as the author of the avadäna knew it, was already 
corrupted, and that, in its original shape, Buddha stated there were 
six. For by changing nägah into nagah the awkward expression hasti 
nägas ca is reinoved, we get two substantives copulated by ca and 
raeaning two different things. So the whole saying gets a satisfying 
content. Six are the asecanakadarmnäh, it is told, an elephant, a tree, 
a king, a sea 7 a mountain and a Buddha. The adj. asecanakadariana 
(so, not ä°) is also found at p. 23, 13 (said of a stüpa) and p. 226, 27. 
227, 26. 251, 21. 361, 15. 366, 8. 390, 29. 547, 12 (said of Buddhas). 

XXIII (Saftgharaksitävadäna). 

LXXI. As f to put in fire' is in Sanskrit agnim dätum, not a. 
dagdhum % at p. 337, 25 the good reading must be tasmin vihäre \jnir 
dattah (cp. p. 261, 1 and 4). That MSS. have "gnir dagdham is 
either the consequence of a gloss that crept into the context, or 
of a copy ist's inadvertency, cp. dagdhäh 1. 26. 

LXXII. P. 338, 17 the printed text has saSukladharmah, as if 
it were one word. Read : tatraika rsih sa iukladharmah (perhaps 
°dharmä y as is required by graramar) kathayati. In the avadäna- 
collections it is nothing uncommon to meet with a redundant sa put 
immediately after the subject and eraphasizing, as it were, its function 
as a subject, especially if sorae new personage is introduced. 
Examples: P. 399, 26 tatra Yaso nämnä vrddhah sadabhijhah sa 
uväca 'at that time an old (monk) named Yasah and possessing the 
six abhijnäs said'. P. 558, 26 it is told that the rumour spread that 
king Rudräyana, after abdicating and embracing the State of a monk, 
had arrived at Räjagrha: Rudräyano räjä Bhagavatä pravröjitah sa 
Räjagrham bhiksärthi pravista iti srutvä etc. Cp. p. 373, 19 yadä 
ca Susimali praghätitah tasyäpi mahänagno Bhadräyudho nämnä 
'nekasahasraparivärah sa Bhagavacchäsane pravrajito 'rhan samvrttah. 
Other instances: Lalitavistara (ed. Lefmann) p. 142, 8. 189, 10. 277, 16. 

LXXIII. Instead of rddhii cäpi nirhrtä p. 340, 9 the right 
reading to be restored is rddhis cäbhi nirhrtä, for this is the proper 

£ "ö 
-ö v 

E-e 

E =3 

ft3 <D 

in 4-/ 

- "I nv , li7ö , h ,( Original frann 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



V öl 

.C o 



w I 

fN CO 

f\l ^ 

, O) 

o y 



o 2 



F P. 



344 J. S. Speyer. 

terra used to signify the acquisition of magical powers, cp. p. 48, 15. 
49 ; 13, Lalitavistara (ed. Lefm.) p. 180, 6 and Avadänasataka avad. 71 
(Cambr. MS. Add. 1611, f. 66, b 7) abhinirhäraäca krtah. 

XXVI (pfimsupradfmävadäna). 

LXXIV. On the pages 354 and 355 the metrical portions, though 
not denoted by alineas, are sufficiently pointed out as such by means 
of double dandas put at the end of the stanzas (or half-stanzas). 
The indication wants to be corrected at p. 354, 1, where we must 
divide the text in this way : 

idänlm tu 
etasyäh Jcälo 'yain drastum gatamänarägaharsäyäh \ 
nisitäsiviksatäyäh svabhävaniyatasya rüpasya || 

the first two words standing extra versum. This äryä, for the rest, 
has been well preserved in MSS., not so another at p. 355, 26 foll., 
the second pcäda of which is too long; it may be healed by changing 
dhavala into vara. 

Two other slight corrections. P. 355, 15 read pandita, the 
vocative being required, not the nomin., and ib. 1. 23 supunyä for 
svapunyä. That it must be supunyä is evident from the many 

in 

repetitions of the upajäti stanza, e. g. in Avadänasataka avad. 27 and 
51 — 59. Cp. infra xcix. 

LXXV. P. 357, 18 the edition has prltimanasä, likewise p. 397, 
11. 398, 19. 400, 6 prltimanä; p. 404, 25 pritimanaso* p. 449, 4 priti- 
manasas. In all these forms prlti- is erroneous. It must be, of course, 
prlta-. Nor has the wrong acceptation, though frequent, ousted the 
right one everywhere. The just form of the bahuvrihi has sometimes 
remained intact in MSS, see p. 386, 16 prltamanasä; p. 395, 3. 405, 
27. 425, 22 prltamanäh. From the non-Buddhistical litterature cp. 
e. g. Bhagavadgltä 11, 49 vyapetabhlh prltamanäh punas tvara \ tad 






<=> o 



F P. 



> 

"c 

— o 



eva me rupam idarrt prapaSya. 1 



1 A similar fault occurs on p. 404. MSS have four times krtditafy with the 
meaning ,they two play', which should be corrected, of course, into kr%4atal$. 



2 T5 

ifl tn 

£ -o 

-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CrITICAL REMARKS Ofl THE TßXT OF THE DlVYAVAüANA. 345 

LXXVL P. 358 — 360. In the episode of Mära's taming by 
Upagupta different excellent corrections, especially in the metrical 
parts, have been proposed by Windisch and Böhtlingk, see the 
former's Mära und Buddha, p. 168 foll. Here are some other ob- 
servations, bearing on the text of this episode. 

1. Upagupta, by dint of his supernatural power, has bound 
three corpses of a serpent, a dog and a man to the head, neck and 
ear of Mära. Being thus put into contact with three corpses, how 
can Mära be said to endeavour to strip off ,that corpse'? Accordingly 
p. 358, 7 in the passage athä Märas tarn kunapam apanetum ärabdhah 
we have to correct atha Märali ivakunapam etc., for 1. 10 of that 
page Mära says: mokturrt na Sakyämi kanthät svakunapam. 

2. P. 358, 15 correct: sa Mahendra Väsavädln 

devän abhigamyä . 

3. P. 358, 17 the corrupt äryä by which Mära declares his in- 
feriority to the disciple of Buddha may be restored in this mann er: 

sisyena Dasabalasya svayam rddhyä (ya) 1 krtä hi maryädä \ 
kas täm bhettum, Sakto veläi\i Varunälayasyeva \\ 

4. At p. 359 the loss of a monosyllable disturbs the metre twice. 
The first line of the anusjubh 1. 15 foll. has to be constituted in this way: 

tvayä punar aham vira tyaktvä (sväm) sahajäm dayäm, 
and at 1. 21 I suppose we have to read: 

yadartham (tvam) Bhagavatä säparädho "pi marsitah] 

the yadartham of MSS has been wrongly changed by the editors 
into yardarthena, the instrumental being out of place here. 2 

5. P. 360, 21. — In the passage, where Upagupta Orders Mära 
to show him by magic the figure of Gautama Buddha, the vaitallya 
stanza is disfigured by two faults, which obscure also the understand- 
ing. What at all can be ineant by this sentence ? tad anadyam 
anugraharp, prati tvam iha vidariaya Buddhavigraham. Windisch 
showed the way to correction, proposing instead of anadyam a word 

— o 

c o 



CÜ 



t! öi 



w l 

CN tO 

fN ^ 

, O) 

° m 

i fD 



c v> 
o E 



F P. 



O) «fl 



1 Cp. nr. XX. 

2 P. 359, 14 viprayam is, of course, a typothetical errror. 

in lh 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



346 J. S. Speyer. 

very similar to it from a palaeographical point of view, viz. anar- 
gham. I would apply a slight modification and read anarghyam, that 
seems preferable. There remains how to get rid of the prepos. pra- 
ti, which will not do here. The reading apratimam, as the editors 
have put into the text, cannot be the proper correction. I seek the 
fault not in tvam, but in prati and propose this form of the verse: 

tad anarghyam anugraharri mayi 

tvam iha vidarSaya Buddhavigraham* 

by this emendation the locative of the person on whom the benefit 
is to be bestowed, the absence of which would be stränge, appears 
at the same time. 

LXXVII. P. 362, 23 foll. — Mära has fulfilled the wish of his 
spiritual teacher. He has shown himself in the shape of Buddha 
to the admiring eyes of Upagupta, who overwhelmed by delight 
and veneration prostrates himself at the feet of him who bears only 
the appearance of the Lord. Mära, having warned before Upagupta 
that he should not forget he was to behold only the likeness of the 
Teacher, not Buddha himself, and therefore should avoid from pro- 
strating himself, is confounded by that unbecoming act. He reminds 
Upagupta of the agreement. The other replies that it is not he, 
Mära, whom he adores, but the person represented, just as people 
venerating earthen images of gods do not revere the clay but the 
immortal ones represented by them. This discourse is written partly 
in prose, partly in verse. The stanza, 1. 23 — 27, is composed in the 
metre mälini, in päda c the laws of that metre require nayanakäntäm 
for °käntim. Päda a sufFers by a grosser fault. The translation 
,Bekenner' which Windisch (op. cit. p. 174) gives for vädipradhäna, 
conceals it, but that translation does not suit our text. It is not 
Upagupta, who could at no rate say of himself that he had reached 






w I 

fN tO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



F P. 



u 

«4- ~° 



already nirväna, but Buddha who is denoted by that epithet. The 

> 0) 

B ° 

the corrupt jf^g, which disturbs the whole turn of the sentence, into 



füll meaning of the utterance of Upagupta reappears by correcting 
the corrupt jf^g, which disturbs the who 
^fr^T. The mälini, then, runs as follows: 



ifl tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CRITICAL ReMARKS ON THE TeXT OF THE DlVYAVADANA. 347 

na khalu na viditam me yat sa vädipradhäno 

jalavihata ivägnir nirv^tim samprayätah \ 

api tu nayanakäntäm äkrtim tasya drstvä 

tarn psim abhinato 'harrt tvärri tu näbhyarcayämi || 

,Indeed, I am well aware of this that the foremost of teachers has 
passed away into nirväna, yet beholding his lovely likeness I have 
bowed to that Rsi, it is not you whom I worship/ 

LXXVIIL P. 371, 29 Bindusära Orders his son A§oka to subdue 
the rebellious Citizens of Taksasilä : gaccha kumära Taksasilänagaram 
samnämaya. Thus we have to read, not samnähaya which signifies 
the equiping of an army. Cp. p. 372, 24 na ca sakyate samnämayitum 
,and it cannot be subdued', also 407, 27. 446, 1. 451, 15. 

LXXIX. The aksara t put instead of st (cp. p. 123, foot-note 
of my first article) has adulterated the text on p. 377, 12. The monk 
Samudra by ill luck has become a prisoner of the cruel gaoler Can- 
(Jagirika, who having the right to put him to death is disposed to 
execute him. His craving for mercy is fruitless, he can obtain nothing 
but a week's delay of death. That the author of this story states 
the poor monk to have been maranabhayodvignahrdayah saptarätrena 
me na bhavitavyam iti is no wonder, bui what to say of what is 
added, vyäyatamatih samvrttah? As vyäyata means 'long' and nothing 
eise, the meaning of these words cannot import but this that ,his 
mind became long or extended', which is nonsense. The author 
must have written vyäyastamatih 'troublesome — , sad of mind\ 

A little further on, in the description of the preparation of the 
fire on which the monk is to be boiled alive, and of the miracle 
that ensued, several corrections are necessary, I think. I will write 
down the passage in füll, with my conjectures marked by spaced 
types (p. 378, 9 — 14): tatas tena nirghpiena därunahrdayena para- 
lokanirapeksena rosävistena bahüdakäyCuu sthälyäm nararudhirava- 
sämütrapiirisäsamkuläyäni mahälohyäm praknptah ! prabhütendhanais 
cägnih prajvälitah \ sa ca bahunäptndhanaksepena na samtapyate \ 
tatah prajvälayitum (ärabdhah) | yadä tathäpi na prajvalati tato 



.c o 



w I 

fN tO 

f\l ^ 

, O) 

O u 



o o 

c v> 
o 2 



fO 

F P- 



u 

«4- "ö 

O <L> 

*s 

'i/i öi 

£ ■? 

> <U 

C CT 

=) O 

— o 

c ü 



fü 

£ -ö 

23** 

o c 

E => 

fO <D 
10 4-J 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



348 J. S. Speyer. 

vicärya täm lohirp, paiyati tarn bhikswji padmasyopari paryahkeno- 
pavistam. In the preceding line (8) read : &arlrarri dirghäyur etc. 
LXXX. At p. 380, 9 I surmise that it must be tayaiva rddhyä 
prakräntaJi instead of tadeva etc., 1. 11 mä tävan mäm aplcchasi 
ghätayitum (MSS have mamäplcchasi), 1. 28 iraddhälü instead of 
Sraddhäbhü. In 1. 24 separate nägai räjä. For the rest, the tristubh 
stanza at the bottom of the page seems too utterly corrupted as to 
give any chance to emendation by conjecture. 

XXVII (Kunälävadäna). 

LXXXI. P. 383, 25 foll. — Asoka reprehending his minister 
YaSas who had blained his devotion to the Buddhist clergy, among 
other arguments quotes a well-known saying of the Lord ; that riches 
are worthless save if given away in charity. In the särdülavikrlijita 
stanza where this quotation occurs one word is utterly devoid of 
meaning, viz. yantrbhyo (so ABC, yanbhrtyo in the Paris MS D is 
caused by the copyist's confounding Nepalese t and bh). The true 
reading is not ^irf^ft hu* ^^T^ft, so that the first and second pädas 
of the stanza get this form : 

kirn te kärunikasya Säkyavfsabhasyaitad vaco na £rutam 
präjnaih säram asärakebhya iha vastubhyo grahltum ksamam 

,have you never heard of this saying of the compassionate oäkya 
hero : the wise are able to obtain in this world worth from worthless 
objects/ 

LXXXII. Upagupta on his conducting king Asoka around the 
holy places remarkable by some important event in the life of the 
Teacher, is wont to explain with a few words the several facts for 
which each spot has got its reputation. So, coming to the place 
where once stood the penance-grove of Aräcja and Udraka, he pro- 
nounces a sloka commemorative of the Lord having been a disciple 



.c o 



w i 

fN tO 

f\l ^ 

, O) 

O u 

O o 

c ^ 

o E 



(T3 



§ S 



adhigatäcaryasattvena purusendrena tapitä \\ 



O <L> 

*S 

■h! ■— 
'i/i öi 

of those teachers. This öloka has been edited thus (p. 392, 3 foll.) 

CO 
— 

Udrakärädakä näma rsayo 'smin tapovane \ 

_^ fu 

£ -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

- 

ü Q_ 



Original from 



CRITICAL ReMARES ON THE TEXT OF THE DlVYAVADANA. 349 

Whether päda c is corrupt or not, may remain uncertain, for the 
irregulär sandhi may be due to the author of the poor poetry and 
the bad Sanskrit of this avadäna — as to the plural cp. sub vn — , 
but in päda d the last word täpitä cannot be sound. If I mistake 
not, these meaningless three aksaras represent a misread fTTf^TT. 
Täyin(ä) has passed into the Sanskrit of the Northern Buddhists 
from some populär dialect(s), where older and Päli tädin(ä) had 
beeome täyin{ä). It occurs once more in the fragment between avad. 
nr. 37 and 38 (in MS A f. 251 b), see Divy. p. 712 in the beginning, 
on which occasion the editors, in a foot-note, quote Burnouf Intro- 
duction p. 227 n., who first drew the attention to the word täyin, which 
he found in some passages of the metrical redaction of Kärancjavyüha. 
How tädi = skt. tädri has got the meaning 'holy' and is with that 
meaning said of the Tathägata, is explained by Childers in his Dictio- 
nary s.v. In a passage of the Avadänasataka, tale nr. 100, täyinah is 
likewise the equivalent of Päli tädino, see ZDMG. 7 liii, 122 foll., and 
in Lalitavistara p. 388, 13 (ed. Lefm.) we find arhantebhi ca täyibhih. 

LXXXIII. In the following pages the story of Kunäla is beset 
with many greater or lesser depravations and gaps of the text, most 
of which I refrain from healing or Alling up. I confine myself to a 
few proposals of restoration. 

P. 398, 27 I read snätvähatäni väsärrisi naväni dirghadasäni 
prävrtya, MSS have dlrghadaSädi. Cp. p. 394, 12 another instance of 
d and n interchanged, for Burnouf's conjecture vaineyasattvavirahäd 
hits the mark. — P. 399, 12 raye seems to be miswritten for ca ye. 
— P. 400, 19 tau jänumandalau is wrong, either dvau (cp. p. 387, 7) 
or üb hau ought to be read. — Ibid. 1. 23 the repeated pronoun me 
cannot be genuine, I hold the second me to represent a misread yä ; 
the whole stanza, an upajäti, I read therefore as follows : 



.c o 



w I 

fN «/> 

, O) 

o y 



o E 



(T3 



2 5 



F P. 



yadä mayä Satruganän nihatya 

präptä samudräbharanä sa&ailä \ 

ekätapaträ prthivl tadä me 

prltir na sä yä sthaviram nirlksya \\ 



O <L> 

*S 

'i/i öi 

> <U 
C CT 
=) O 

— o 

CO 

£ -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



350 J. S. Speyer. 

P. 407, 20 foll. the äryä which commences with mama bhavatu 
is defect in two places, mätu being adverse to the metre and 
sajjanajana to the obvious meaning of the sentence. Both incon- 
veniences would be removed, if the stanza be read as follows : 

mama bhavatu maranam amba sthitasya dharme viSuddhabhävasya 
na tu jivitena käryarrt sajjanaglrdhikkxtena mama || 

The former of these corrections supposes the fact that amba has 
been ousted by its synonym. As to the latter one, the syllable gi(i % ) 
may have dropped by an oversight of some copyist, in the place of 
which, to fill up the metrical gap, some other copyist writing a 
line deficient of two morae repeated the syllables Jana. At all events, 
something like sajjanagir- is the term required by the context, 
cp. dhigväda in Jätakamälä, see Pet. Wörterb. in kürz. Fassung 
vn, 351. 

At p. 412, 4 the second line of the anustubh which contains 
the laments of the people witnessing the blinding of Kunäla does 
not admit of a satisfying interpretation in consequence of the cor- 
ruption of two words. It should be read in this way : puntfarlka- 
vanäc cäpi irlmän utpätyate 'mbujah. — What can be the meaning 
of ca in the sloka (p. 413, 28) 



T3 






w i 

fN tO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



caksurädlni yah prajnah paSyaty äyatanäni ca \ 
jnänadlpena iuddhena sa samsäräd vimocyate || ? 



It is not ca, which is superfluous here, that is required, but the 
noun of number sat, caksuh and the rest being the wellknown six 
äyatanäni. Kunäla sings this : ,The wise man, who contemplates 
the six abodes (of sensual impressions), the eye and the rest, with 
the pure lamp of Knowledge, he gets released from Sainsära.' — 
At p. 415, 3 I conjecture : dhärmiko "pi tu putro *hairi Buddha- 
syädityabandhunah, with the gen. in -unah cp. mrtyunah p. 162, 22 
etc. — At p. 415, 17 I would read: tato muhürtarri nrpa äSvasitvä 
kanthe parisvajya tarn aSrukanthah (MSS ra$ä$ru°). 



> <u 

C CT 

=> o 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CRITICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 351 

XXVIII (Vitasokävadäna). 

LXXXIV. It seems that at p. 420, 7 the editors by the fashion 
of Burnouf's translation, which is here excellent as regards the 
content of the sentence but not quite literal, have been adduced 
to alter the reading of MSS without necessity. When Vltaäoka 
hears from some rsi who lives in the forest as an anachoret this 
utterance, that though living on forest-fruits and roots, being clothed 
in bark and sleeping on a grass-couch he feels himself not wholly 
freed from Passion (räga), he considers the disciples of Säkyamuni 
who enjoy a much better food, clothing and lodging to be a fortiori 
unable to restrain the impetus of passion. What then is the fault in 
the text thus transmitted? asya [viz. rseh] kastena tapasä rägo 'dyäpi 
bädhate präg eva Sramanäh Säkyaputrlyäh svästirnäsanaiayanopase- 
vinah kuta esärrt rägaprahänam bhavisyati. The words rägo "dyäpi 
bädhate are irreproachable both with respect to their form and 
meaning. They signify : Tassion troubles (him) even now' and have 
substantially the same content as in the subsequent stanza the phrase 
rägo naiva jito yadiha rsinä. To conclude, the reading of A is to 
be put into the text ; bädhyate in the other MSS is corrupt, and 
the insertion of the negation erroneous. 

LXXXV. P. 420, 16 read kärän karoti instead of käräm karoti. 
Every one aware of the practice of manuscripts knows that the 
orthography with anusvära or n can not be relied upon as a proper 
test for determining how to spell a given form. Now, in most in- 
stances where this term occurs in mss. of avadäna-texts, the subst. 
written käräm may be accepted as the acc. plur. of masc. kära as 
well as the acc. sing, of femin. kärä. A few passages fortunately enable 
us to cut the knot, as Divyäd. p. 166, 26 ye 'Ipän api jine kärän 



CÜ 



t! öi 



w l 

fN tO 

f\l ^ 

, O) 

O o 

c v> 

o 2 



F P. 



u 

«4- ~° 



karisyanti vinäyake ; p. 228, 16 karah. kftä ...... mahaphalä bha- 

vanti; Avadänaöataka, avad. nr. 61 (Cambr. Add. 1611, f. 59 a 12) 
yat tena VipaSyinah Samyaksambuddhasya käräh kftäs tena etc. 
Böhtlingk in his Worterb. in kürzerer Fassung, vn, 331 for similar 
considerations, I think, and also because the corresponding Päli word 



> <u 

=) O 

' o 



5 s 

ifl tn 

£ -o 
-o v 

E-e 

E => 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



352 J. S. Speyer. 

is käro, has registered the word as a masculine. Accordingly there 
is no more room for such doubt as the editors express on p. 678 
(Index), and wheresoever the printed text has the femin. singular, 
as p. 23, 23. 47, 21. 289, 6. 583, 29, it must be changed into the 
masc. plural. 

LXXXVI. I pass over sundry disturbed passages on p. 421 
and 422, but stop a moment to consider the beginning of p. 424, 
where occurs a common-place in avadäna literature : a householder 
dissuading from his purpose somebody who is about to leave the 
world, chiefly by painting in black the discomfort and misery of a 
beggar monk's life. Here it is king A6oka who withholds in this 
manner his brother Vitasoka. I put here a part of their conversation, 
where I propose some corrections, that are marked by spaced printing. 
The king says : pravrajyä khalu vaivarnikäbhyupagatä \ väsah päm- 
sukülam prävaranam parajanojjhitam ähäro bhaiksyarp, parakule 
sayanäsanam 1 vrksamüle trnasamstarah parnasamstaro (va) vyäbädhe 
khalv api bhaisajyam asulabharrt püti iuktarrt ca bhojanam \ tvam 
ca sukumärah Sltosnakmtpipäsänäm duhkhänäm asahisnuh \ praslda 
nivartaya mänasam \\ Vitasoka uväca \ deva 

naiväham jätu nun am visayatrsito näyäsavihatah etc. 

The last correction restores both the sentence and the metre of 
that first päda of a suvadanä stanza. The whole passage conveys 
this meaning : ,The state of a homeless mendicant is on a par with 
that of an outcast. 2 His undergarment is made up of rags gathered 
on dustheaps, his upper-garment a cloak put aside by other people, 
he gets his food by begging at the homes of other people, his dwelling 
is a couch of grass or leaves at the foot of some tree, when sick 
he can scarcely obtain medicine, and his food is putrid and vapid. 



0} 






Cl 



.TD 



<=> o 



(T3 



> £ 



U 

1 Perhaps Senäsanam, MSS have cchanäsanam. 

2 This seems to me to be the signification of vaivarnikäbhyupagatä predicated 
of the subject pravrajyä] it expresses summarily that which is exposed in parti- 
culars by the following sentences. The Petropolitan Dietionary does not mention 
vaivarnika, an onza% Xeyollevov. Bürnouf translates : ,dans la vie de mendiant, on a 

^ O) 

des rapports et on vit avec des gens de castes infeneures/ 

w tn 

£ -o 
-ö v 

E-e 

E =3 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

O Q_ 



Original from 



CRITICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 353 

You, on the otlier hand, are very delicate and unable to endure the 
hardships of cold, heat, hunger and thirst. Favour rae to change 
your inind.' Vitasoka replied : ,Majesty, forsooth I do not at all crave 
for wordly pleasures nor do I allow myself to be checked by toil/ 

LXXXVII. Vitaöoka has promised to his brother, he would 
come back to him if he once would have reached Arhatship (p. 424, 22). 
On this condition having been allowed to join the Saögha, he goes 
to Kurkutäräma, in which place, owing to his spiritual exertions, he 
succeeds in becoraing an Arhat (ibid., 1. 22 — 25). Then he reflects, 
and reaches the palace of A6oka (ibid., 1. 26, 27). Neither the con- 
tent of his reflection, which must have been no other but the re- 
membrance of the proraise he had made before to his brother, nor 
the fact of his leaving Kurkutäräma is nientioned in our text. For 
what reason these indispensable links in the narration should be 
missing? There must be a gap, owing to a copyist's oversight, 
who having to copy a passage where the words räjno "sokasya 
occurred twice, after he had written these words for the first time 
continued copying what followed after their second occurrence 
omitting meanwhile all that was between. Therefore, I believe the 
text is thus to be constituted at p. 424, 27: astl khalu me püvvam 
räjfio 'Sokasya (pratijüätam * * * •;• •:• * •:• räjno "sokasya) grhadväram 
anupräptam. Burnouf's translation (Introduction p. 421) ,1a premiere 
chose qu'il fit, fut de se rendre k la porte du roi A9oka' misleads 
by its arbitrariness about the true State of the text. 

Sorne lines further on another gap raay be easily restored 
(p. 425, 5 foll.) : mülanikrtta iva drumah sarva£ariren(a pädayor 
nipaty)äyusmantarri Vltaiokam niriksamänah etc. 



CÜ 



ti öi 



w i 

fN tO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



u 

O <L> 



XXIX (Aäokävadäna). 

a rule the verses that c 
been depravated in a considerably worse manner than the prose. 



LXXXVIII. As a rule the verses that occur in our text have 



> <u 

=) o 

— o 

Few, however, will have come down to us, I think, in a more per- 
verse state than the äryä Strophe, p. 431, 10 — 12. It is uttered by 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



354 J. S. Speyer. 

king Asoka in the course of his complaint that he ; once the might- 
iest monarch on earth, now being at death's door, is disobeyed and 
checked in his most pious wishes. Bürnouf despaired of translating 
this stanza. ,Je passe ici une stance', so he writes (1. 1. p. 428 note), 
; qui est absolument inintelligible et a peine lisible dans nos deux 
manuscrits ; il en manque m6me la moitte dans la copie du Divya 
avadana que je poss&de. Cette stance renferme certainement une 
de ces sentences morales sur la vanit^ de la puissance humaine, que 
les legendes du Nord expriment ordinairement en un style assez 

o 

plat et assez vulgaire. La fin de la stance roule, si je ne me trornpe, 
sur une comparaison emprunt^e k un fleuve qui remonte, arrßt^ par 
les roches detachees d'une grande montagne/ Cowell and Neil, 
who disposed of inore manuscripts, have edited it in this form : 
prattiisyate 'smart naciräjnä mama yävati yathä manasä sä dyai 
mahädriHlätalavihitavan nadipratinirvrttä, they add in a foot-note: 
jUnintelligible, see Burnoup Intv} p. 428: manasädyai and ^ilatale A.' 
Considering that three points are certain here, l ly pratiSisyate is a 
corrupted pratisidhyate, as the disobedience to the royal order is 
the topic by which the utterance is occasioned, 2 ly in the third 
complex is hidden the nom. äjnä 'order and not the instr. räjiiä, 
3 ly to sä in the second line there must correspond in the first line 
somewhere yä, I venture to propose this attempt to emendation, 
which brings back the meaning of the stanza and may, perhaps, to 
a certain extent represent the very words of the author : 



o E 



F p. 



pratisidhyate sma na (kaiS) cid äjnä mama yä ratir yathamanasä\ 
sädya mahädriHlätalavihateva nadl pratinivfttä || 



Translation : ; My Orders which formerly nobody disobeyed, as little as 
the Internal Sense opposes itself to Pleasure are now checked like a 
river stopped by the rocks of a big mountain/ The palaeographic 
probability of the origin of the faults will appear to those familiär 
with Nepalese manuscripts ; as to pratinivfttä cp. nr. xvm. 



C CT 
=> O 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



CRITICAL REMARKS ON THE TfiXT OF THE DlVYAVADANA. 355 

XXX (Sudhanakumärävadäna). 

LXXXIX. In this avadäna, among other slight corrections 
to be made, I notice p. 435, 4 babhüvatur Uttara instead of °vatu 
Utta , ru and u being almost identical in Nepalese writing; 1 ibid. 
1. 7 read: °syam pra§äntakalikalaha° as appears from numerous 
parallel passages ; — p. 437, 29 read: tarn nägapotakam ito visayäd 
apahare(c cet) tasya nägapotakasya kirn syät, cp. my edition of the 
Avadänaäataka p. 23, n. 2 ; — p. 443, 27 alter vaiä into va&e; — 
p. 450, 27 it must be yaksaräksasah, cp. p. 456, 16. 

P. 452, 6. Since prince Sudhana loses his consciousness at the 
news of the disappearance of his beloved wife, the reading of MSS 
sa sokena samuhyate is unmeaning ; correct : sammuhyate. 

P. 453, 4 the editors ought to have approved what they found 
in MSS c fi^^f gf i lTl^qfl'lTT. The reading is irreprehensible. By 
dividing this complex in the right manner we get this : kuto me 
ratir apräpya tarn c how can I feel pleasure without recovering her?' 
the proper expression required. As to the wording cp. ibid., 1. 16 
na Sakyam mayä täm anänzya antahpurasthena bhavitum. 

P. 457, 15 we must read, of course : 

kirn bho mahärnavajalam na vigähitavyam 
kirn sarpadasta iti naiva cikitsanlyah. 

The edition has sarpadusta, most likely an error of print. 

XC. At p. 45 7, 22 the edition fails to notice that the prose 
passes into verse. A sloka of six pädas contains the description 
of the town of the Kinnaras and Sudhana's meeting with the Kinnarl 
girls. Perhaps a slight fault in MSS — upagatäh 1. 25, which must 



TS 



Ö. u 
V öl 



w I 

fN CO 

, O) 

O u 



o o 

c v> 
o E 



(T3 



2 I 



F p. 



tracted °kramya u° into °kramyo°. Something similar must be supposed concerning 



1 Another instance of this frequent confusion is found on p. 559, 3, a tliird 
one p. 565, 29. At the former of these quotations the reading of ABC (and pro- 
bably also of Indränand's MS, their original) upasamkramyodräyanam for °kramya 
Rudrä° must have this origin. The aksara ru in some archetype having been read 
u by some copyist, either he hirnseif or some other who copied his writing, con- 

the other passage. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 24 

'TS V 

E-e 

E => 

fD 0) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



356 J. S. Speyer. 

be, of course, upägatäh — obscured the understanding of that fact. 
The whole passage is to be divided thus : 

kumäro 'paiyan nagaram adüram Srlmadudyänopasobhitam 
nänäpuspaphalopetani nänävthagasevitarp, \ 
tadägadlrghikäväptkinnaraih samupävrtam \ 
kinnarls tatra cäpaSyat päniyärtham upägatäh \\ 

Some lines below (p. 457, 28) the meaning of the words spoken 
by the Kinnara girls is perverted by the loss of the negative particle. 
Prince Sudhana, on seeing these girls fetching water in jars in 
order to destroy the human smell that perspired from the body 
of their sister, his wife Manoharä, asks them what they are in 

PO 

want for of so much water. ,Manoharä, they answer, has been in the 
power of men : sä manusyahastagatä babhüva \ tasyäh sa manusya- 
gandho naSyati.' It is just the contrary that ought to be said, viz. 
tasyäh sa manusyagandho (na) naSyati. For if the human smell 
disappeared from itself, for what reason then had they to fetch water 
to pour out over her? 






XXXII (Rüpavatyavadäna). 

XCI. P. 475, 17. — In the exposition of the different work 
belonging to the different kinds of nurses, it is said of the kridä- 
panikä, that she has to take care of the manifold plays and toys 
of the little children. The specified account of the kinds of sport, 
enumerated in this passage, by lack of data to understand it well, 
defies the hermeneutic skill of the interpreter. Its introduction may 
at least be put in order by a correction of the transmitted text, thus 
edited : krldäpanikä dhätry ucyate yäni täni därakänäm daksakänärß 
tarunakänäm krldäpanikäni bhavanti etc. What may be the meaning 
of daksakänäm ? If the word exists at all, it must signify 'clever 
young folk ; yet, in India, as in Europe, it are not exclusively the 
clever children who are allowed to have toys and amuse themselves 



w i 

fN tO 

f\l ^ 

° m 



o E 



F p. 



~ O) 
_N 
'-I-J 

> <u 

=) O 

" o 

with all kinds of sport. But in MSS dahukänärp, is written, not daksa- 
känäm, which is a conjecture of the editors (see note 3 on p. 475). 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CÜ 



.c o 



w I 

fN CO 

f\l ^ 

, 0) 

O o 

c w 

o E 



F P. 



u 

O <L> 
'i/i öi 



o 



CRITICAL REMARKS ON THE TeXT OF THE DlVYAVADANA. 357 

The true reading, methinks, must be daharänäm (or daharakänätri). 
The accumulation of Synonyms : därakänam daharakänäTß taruna- 
känäm is quite Buddhistic. 

On the same page, 1. 23 etad däraka is erroneous. I propose : 
Candraprabho därakas tan därakän etad avocat \ eta därakä vayarri 
sarve 'nuttaräm samyaksambodhim abhisambodhau cittam utpädayema. 
,Little C. said to the other boys : r now then, boys, let all of us 
make up our mind to strive for Highest WisdomV When addressing 
more persons, eta may be used as a synonym of ehi, with the force 
of an adhortative particle, as lat. agitedum compared with agedura. 
So Avadänasataka, nr. 14 (p. 78, 8 of my ed.) sa Nädakantheyän 
brähmanagrhapatln idam avocat \ eta Buddham iaranarp, gacchata. 
In a similar way has to be corrected Laiita vistara p. 23, 4 (ed. Lefm.): 
eta (ed. etan) mär sä etam eva Bodhisattvam upasarrikramya pari- 
praksyämah c come, friends, let us go up to the Bodhisattva himself 



and ask him\ 



XXXV (Cü<Jäpak§ävadäna). 

XCII. P. 500, 6. — In the famous story of the young merchant 
who starting with a dead mouse as his capital, got immense wealth, 
it is told how having obtained for his mouse some peas he placed 
himself at evening-time near the city-gate at the encounter of the 
woodcutters coming back from the wood, to whom he offered those 
leguminous seeds and fresh, cold water : tesärp, kaläyänärri stokam 
dattai]i Sttalaiji ca pänlyani pätam. The last word is manifestly 
corrupt ; the editors add this note : Sic ABC, päyam D. The fault 
may be easily corrected by reading iltalarift ca päniyarp pätum 'and 
cold water for drinkin g\ 

In what immediately follows te kathayanti | bhägineya kva 
yäsyasi \ kästhänäm, that simple genitive which makes up the young 
merchant's answer, cannot be right. Either arthäya has dropped 
after it, or what seems more likely, kästhänäm may be a depravation 



of kästhärthi , in this case the young man replies : T want to 

get logs. 

24* 

'-o v 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 



ü Q_ 



Original from 



358 J. S. Speyer. 

XCIII. The description of the bright and the dark side of 
traffic over sea on p. 502 Stands in need of two slight corrections. 
It is proper that the helmsman, being ßummoned to exhort the 
merchants to embark, pronounces the praise of the sea ; here, then, 
the chief merchant's words kathaya kathaya bhoh purusa yaihä- 
bhütam mahäsamudrasya varnam are fit. But afterwards, when the 
number of merchants ready to partake of the journey threatens to 
exceed the capacity of the vessel, it becomes advisable to make the 
helmsman proclaim also the bad chances of a sea voyage. It is no 
more the praise but, on the contrary, the blame of the sea which 
is wanted to be made known. For this reason I believe we must 
read p. 502, 16 thus : gho$aya bhoh purusa mahäsamudrasya yathä- 
bhütam avarnam. See for avarna = 'blame' Petropol. Dict. i, 486. 
v, 1062. Wörterb. in k. Fass. i, 125; to the instances adduced there 
may be added one from our Divyävadäna (p. 272, 25) rathyävltfyica- 
tvarafyfigätakesu cävarnam nUcärayämah r we will proclaim (your) 
bkme on the highways etc.', and one from the Avadänasataka, avad. 

nr. 47 (MS Cambr. Add. 1611, f. 45 a 5 tayä Saiksäiaiksäxiäm 

ca avarno bhäsitah). — In the sequel among the mischiefs by which 
travellers over sea are liable to be overtaken the occurrence of pirates 
is mentioned. It seems that this is said with a small admixture of 
jeßting, if I rightly understand the passage p. 502, 21 as meaning 
c highway robbers with dark sails'. The printed text has caurä apy 
aträgacchanti nllaih sitair vanacärino etc., I read sitair instead of 
sitair. The word Sita c saiF occurs in the Süpärakajätaka of the 
Jätakamälä, p. 94, 8 and 10 of Kern's edition who compares Jätaka 
ed. Fausb. iv, 21, 6 rajatamayäni sltäni ahesum. 

XCIV. The impossible form pakvamänänäm (p. 510, 8) must 
be imputed to some clerical error. Correct pacyamänänäm, the 
ligatures for kva and cya being liable to be confounded by copyists. 



t! CT 



w I 

fN tO 

f\l ^ 

, O) 

o y 

O o 

c v> 

o E 



(T3 



2 5 



F P. 



u 



CT 



XCV. In the story of the miraculous horse, narrated on pages 
ölOfoll., which bears some affinity with a similar tale in the Päli 
Jätaka, nr. 254, there is found a very interesting portion in verse 
(p. 512, 14 — 513, 6) making up five aupacchandasika stanzas. This 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



ClUTICAL REMARKS ON THE TEXT OF THE DlVYAVADANA. 359 

old poeiry has come down to us in a lamentable State of depravation. 
The editors have made here and there some good observations for 
the purpose of emendation, but it seems beyond hope to get a 
plausible restitution of its original shape. Here are a few proposals 
bearing on some details. At p. 512, 14 the metre requires ghatlkarasya 
to be changed into ghati , shortening of the l, though offending against 
grammar, is admissible in verse. P. 512, 16 read °sirä° for °sirä°] 

ibid. 1. 17 the vocat. is wanted bahumata tadarthe , cp. p. 123 

foot-note of my first article ; ibid. 1. 20 I propose vada me "dya 
sddhu prstah 'well, teil it me who ask you thereabout'; ibid. instead 
of paramayavärjavadhairya* one should exspect paramajavärja . 

XXXVI (Mäkandikävadäna). 

XCVI. In the narration of Mäkandika offering his daughter 
in marriage to Bhagavän and his refusal to accept her few stanzas 
are exempt of corruption. One of them, p. 519, 8 — 10 may be 
healed by some simple corrections, by the application of which the 
whole, a jagati strophe, would run thus : 

rüpopapannä pramadä alamkftä 

kämärthini yad bhavate pradlyate | 

sahänayä sädhu cared ratim bhavän 

sametya Candro nabhaslva Rohinlm || 

The hiatus pramadä alamkrtä is in fact admissible in Bud- 
dhistic Sanskrit, cp. even such cases as are quoted frora epic Sanskrit 
by Hopkins, The grcat epic of India, p. 199. We have here another 
instance of the hortative particle sädhu not uuderstood by copyists 
and leading them into error, cp. xcv. 

Some lines below (p. 519, 18) prasturjri hi yattäm api notsaheyam 
should be corrected into sprastum hi dattära etc., cp. p. 521, 1. 



"O 



ö. 2> 



w i 

fN tO 

f\l ^ 

, O) 

O o 

c v> 

o E 



(T3 



2 5 



F P. 



u 



XCVIL P. 522, 6 fall, contains the story of the iron-smith's 
daughter whom her father, an exceedingly skilled craftsman, is not 
willing to give in marriage to anybody eise but who surpasses 
himself by his ßkill. Now, a young man, a brahmanical pupil, having 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



0} 






O) 

^ u 

O o 

c v> 
o 5 



(T3 



$ 5 



F P. 



u 

«4- "° 



360 J. S. Speyer. 

learnt from the girl on what condition she is to be wooed, presents 
himself to the trial. The introductory discourse between the youngster 
and the girl is made up of some anusjubhs, the last of which spoken 
by the pupil contains an impossible word : vipratam. 'Sic A' is 
added by the editors in a foot-note, 'tipratarß BC, vipranam D. Qu. 
vitatam. What is hidden under that corruption, will plainly appear 
if we write down the äloka in füll : 

sacet pitä te jänlyäc ckilpam mama hi yädriarri \ 
tväm caivänuprayaccheta anyac ca vipulam dhanam \\ 

The aksaras pu and pra may be easily confounded in Nepalese 
writing. 

XCVIII. The small gap in Anupamä's words, p. 530, 16, may 
be filled up in this way : srutam devena yadi tävat pränätipäto na 
kalpate sramanasyärthäya na kalpate j (atha kalpate) devasyäpi 
kalpate \ devasya na kalpata iti kuta etat. 



XXXVII (Rudräyanävadäna). 



XCIX. The account of the rebirth of pious Candraprabhä in 
heaven, her apparition to Bhagavän at night-time, his preaching the 
Law to her, her conversion and the gorgeous utterance in prose 
and verse of her gratitude is related on p. 552 and foll. in a stereo- 
type fashion, which is often met with in the Avadänaäataka in almost 
the same terms, especially in the avadänas of the sixth decad. 
Hence we are able to emend with absolute certainty some few errors. 
P. 554, 13 it must be caladvimalakundaladharä } not balavadvi , as 
the editors surmise ; p. 555, 1 apävrtä svargagatih supunyä — 
cp. supra lxxiv — ; p. 555, 5 tirnä ca] ibid. 1. 12 jitärini, not 
°ärairi ; 1. 17 svabhavanam. Also it appears from those parallel 
passages that the correction of the editors on p. 555, 14, sasya for 

.> CD 

C CT 
=> O 

— o 

CO 

£ -o 
-ö v 

E-e 

E => 

fD O) 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



samyak, is right. 

C. Finally I will put forth some emendations on the text of 
this 37 th avadäna, though I am well aware that there will remain 



Original from 






CrITICAL RbMARKS ON THE Text OF THE DlVYAVADANA. 361 

still a lot of greater or lesser errors and corruptions unmended, 
especially in the great metrical portion on p. 559 — 562. 

P. 553, 27 MSS and edition: Aryacandraprabhä devl äkähksati, 
I read : ärye (mylady) Candraprabhä etc. 

P. 560, 12 perhaps putradäradhanesu. — Ibid. 1. 20 — 23 I 
correct : 

räjyäni kftväpi mahänubhdvä 

Vfsnyandhakäh Kuravah Pändaväs ca 
sampannacittä yasasä jvalantah etc. 

P. 561, 9 the last word is doubtless Gerate. The poet says that 
it causes displeasure to see the dried heads of dead corpses lying 
dispersed (on the field) like gourds. Metre and sense make upasthä- 
näni suspect, should it be changed into apästäni ? 

P. 564, 18 instead of ko nu virodha iti I guess kontra virodha iti. 

P. 570, 25. By inserting nah editors have restored the first 
word of the sentence, but another fault Stands in need of correction, 
haritalüna being meaningless. I read the sentence thus : ma(nah)So- 
kaSalyenäbhyähato hastalüna iva nado mläyitum ärabdhah. 

P. 571, 8 instead of mämsapeSlm krtvä, which cannot be cor- 
rect, should be read mämsape&im svlkftya, cp. 572, 26 mämsa- 
peHm ädäya. 

P. 573, 22 it is obvious that the phrase pätracivaräni pämSunä 
'vatarisyatiti is no Sanskrit at all. Alter: 'vakarisyatiti. f To 
strew, throw, scatter dust' or f with dusf is pämsum (pämsunä) ava- 
kirati, not avatarati. 

P. 580, 7 Kätyäyana's mother, on seeing her son, can at no 
rate say drstväsya vata putrakam pasyami. We have here an 
instance of a confusion not unfrequent in mss. between drstvä, dfstyä 
and distyä (cp. e. g. p. 405, n. 5; 425, n. 1; 570, n. 3). Taking this 

o v 

into account and adopting the editors 7 supposition that cirasya can 
not be wanting here, I emend : distyä (cira)sya vata [or : bata~\ 
putrakam paiyämi. 

CO 



.E -ö 
-ö v 

E-e 

E => 

fD O) 

10 X-> 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

fN tO 

f\l ^ 

, O) 

O o 

c w 

o E 



(T3 



$ 5 



F P. 



CÜ 



t! öi 



O o 



F P. 






Anzeigen. 



bc>cmo(J)Q^)C>(«)v»j^)ra ^o^>o)«^jcnDo. boc^cag. b«£)6coödob k^cn-j^c^^ * ^gcnv>obo. THIIOl 1 . 

J&HAa,flpe h Xe^aA3e. 1901. [Litterarisches Georgisch. Untersuchung 
von Silowan ÜHüNDADfE. Kutai's.] SS. 239 [nach einer Schluss- 
bemerkung wurde der Druck im Febr. 1902 vollendet]. 



Keiner Schriftsprache bleibt der Kampf um die ^Richtigkeit' 
erspart, so auch nicht der georgischen; ja dem Verfasser der vor- 
liegenden Schrift zufolge würde keine eine solche Mannigfaltigkeit 
von Formen (nämlich gleichbedeutenden) aufzuweisen haben wie die 
georgische, das heisst die jetzige; der alten Sprache rühmt er Ein- 
heitlichkeit nach. Er versucht abzuhelfen, und zwar tut er es mit 

dem Gefühl äusserster Bescheidenheit. Er habe 17 Jahre hindurch 

in 

das Georgische gelehrt und dabei natürlich auch er gelernt; er kenne 
es zwar noch heutigen Tages nicht gründlich, doch habe die lange 
Erfahrung und Erwägung manche Frucht gezeitigt, die er nun vor- 
lege. Den Stoff hat er nicht alphabetisch angeordnet, sondern nach 
der inneren Zusammengehörigkeit, also nicht in SANDERSScher, sondern 
in WüSTMANNScher Weise, ohne freilich von den ,Hauptschwierigkeiten' 
und den ,Sprachdummheiten' etwas zu ahnen und ohne von selbst zu 
einer derartigen Unterscheidung zu gelangen. In langer Reihe werden 
uns paarweise oder auch zudritt, fcuviert Sprech- und Schreibweisen, 



u 

«4- ~° 

- O) 
_N 
'-I-J 

Wortformen, Wörter, Wendungen vorgeführt, und immer einem da- 
von der Preis zuerkannt. Für eine solche Arbeit haben nicht nur 



die Georgier, sondern auch wir Fremden die wir uns mit dem Geor- 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



LlTTERAIUSCHES GEORGISCH. 363 

gischen befassen, dankbar zu sein, allerdings in ganz verschiedenem 
Sinne. Für uns bleibt es gleichgültig was das Richtige oder besser 
gesagt das Richtigere, das Empfehlenswerte ist; auch können wir 
uns des Prüfsteins nicht bedienen der hier am meisten angewendet 
wird. Es ist der , Wohllaut' (joOToe^bacn^Gg&o), unter dem aber, von 
dem so überschriebenen Abschnitt S. 102 — 113 abgesehen, nur selten 
die Eigenschaft bestimmter Lautfolgen verstanden wird, sondern in 
der Regel eine solche Wohlgefälligkeit für das Ohr wie sie durch 
den festen oder häufigen Gebrauch erst erzeugt wird; auch wir 
pflegen uns ähnlich auszudrücken, wir sagen z. B., kauft laute 
besser als kauft. Der Verf. aber scheint sich dieser Bedeutung 
des Wortes nicht bewusst geworden zu sein, sonst könnte er nicht 
etwas als ,ungesetzmässig und zugleich nicht wohllautend' bezeichnen, 
wie er das öfters tut, z. B. S. 40; wenn 3 für 3 in cVbogcoo statt 0*08(00 
u. s. w. zwar bei den Ostgeorgiern häufig, aber ungesetzmässig 
ist, inwiefern ist es denn weniger wohllautend als in Isoeoagooo und 
den vielen Verbalformen wo es gesetzmässig ist? Zu den Entschei- 
dungen könnte ich höchstens hie und da ein nebensächliches Frage- 
zeichen an den Rand setzen. S. 147 wird dem volkstümlichen «g9obrao) 
unter den Ausdrücken für ,ohne' eine gute Zukunft verheissen. Es 
ist mir nicht ganz klar in welchem Umfang schon heute das Wort 
in diesem Sinne vorkommt; es bedeutet eigentlich ,ohne ihn', und 
nur so verdolmetschen es die Wörterbücher. Der Übergang würde 
ein ähnlicher sein wie beim franz. avec ,mit diesem' { ,mit'; nur könnte 
im Georgischen die Verbindung mit dem adjektivischen Pronomen zu 
Grunde liegen: aus «g3ob jOQoboaco ,ohne jenen Menschen' durch Um- 
stellung geworden sein j^Qob <g8obaxa>, und sich dann hier der demon- 
strative Sinn verdunkelt haben. — S. 149 werden die häufig ge- 
brauchten boFo9 ,solange als' ,bis' und 9oW3 ,so lange' für b^8 und 
9oG"o9 ,sehr übellautend und ungesetzmässig' genannt, weil diese von boco 
und 9o6eo ausgegangen seien; aber das letztere bezweifele ich, ich 
denke eher an den Genetiv 9o(b); die eine Form würde zunächst -o-, 
die andere -0- gehabt und sie dann in doppelter Richtung sich an- 
geglichen haben, sonst wäre ja das Auftreten des -o- überhaupt nicht zu 



t; öi 



■o 



.TD 



F P. 



u 

«4- ~° 



5 s 

24** 

E => 

(ü <D 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



364 SlLOWAN CHUNDADfE. 

erklären. Übrigens ist bo6o9(oob früh belegt: aus dem Daredzaniani. 
Die Hauptsache für uns ist die Aufstellung und Aufhellung der 
Tatsachen. Wir werden, worüber die sonstigen Quellen meistens 
versagen, über ihre Verbreitung nach Zeit und Raum unterrichtet, 
vor allem darüber ob sie im Ostgeorgischen (Amerischen) oder im 
Westgeorgischen (Imerischen) zu Hause sind und ob sie die Schrift- 
steller aus der Mundart ihrer engeren Heimat aufgenommen haben; 
so stellen, um ein recht auffälliges Beispiel anzuführen, heutzutage 
die amerischen Schriftsteller den attributiven Genetiv einem Sub- 
stantiv nach, die imerischen vor (S. 124). — Auch werden die Be- 
deutungen näher bestimmt und hie und da auf die kleinen Unter- 
schiede der Synonymen hingewiesen. Der Verfasser zeigt z.B. S. 176 
dass von den beiden Wörtern für , nackt': 'Bo^e™ und ö°(!)30cr o j enes 
nicht auf völlige Nacktheit sich bezieht, wohl aber dieses, dem er 
dann als genau entsprechendes Wort das mir nur vom Lesen her 
bekannte cjoco^^&oer (eig. , muttergeboren'; vgl. unser ,mutter[faden]- 
nackt') hätte zur Seite setzen können. Nicht bei Töübinow, wohl 
aber beim alten ürbeliani, den zu erwähnen der Verfasser bei seinen 
synonymischen Betrachtungen andere Gelegenheiten versäumt hat, 
findet sich der Unterschied angegeben. Diese beiden Wörter, welche 
auch miteinander verbunden vorkommen (öoögge^-^^e^o), und ein 
drittes, c?°G?30c™ ,nackt', vom federlosen Vogel, verhalten sich offen- 
bar wie drei Varianten zueinander (vgl. laf. t § unt$u oder djUndjU 
,nackt'). Im allgemeinen aber handelt es sich bei dem hier vor- 
gelegten Stoff nicht um Divergenz, sondern um Konvergenz, und 
unsere Aufgabe besteht darin die verschiedenen Quellen des Gleich- 
wertigen aufzudecken. Der fremde Ursprung ist am leichtesten er- 
kennbar bei den einzelnen Wörtern, immer und ohne weiteres bei 
den Entlehnungen aus dem Russischen, die ja erst der jüngsten 
Zeit angehören. S. 178 f. bespricht der Verfasser drei von diesen: 
l>£)oacwo } cuzojtz, b^o^oEHV | cmaiam, ajoQoEToabo 1 zzodnoci (man bemerke in 
den beiden letzten Fällen die Wiedergabe der russ. Tenuis durch die 






w I 

fN CO 

f\l ^ 

, O) 

° m 



c v> 
o E 



(T3 



u 

«4- ~° 

O <L> 



> <u 

3 O 

georg. Aspirata; vgl. meine Schrift Über das Georgische S. 10). Für 

"cD ^ 

das letzte Wort habe das Georgische boa&fo; aber auch dies ist ja Fremd- 
le tn 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Litterarisches Georgisch. 365 

wort, nämlich \ pers. <^?\^ 7 und das wusste schon Orbeliani (freilich 
sagt er nur: bb^coa 36^). Wenn dieser aber nun fortfährt: ,auf georgisch 
heisst es bogc^ un( i ö^j°S so verkennt er dass auch dies Fremd- 
wörter sind; bogcmo (so auch als Schlagwort bei O.), bogocmo, bogo^, 
b^gocm^ welches kaum, wie Töübinow angibt, vom franz. sebile her- 
kommen kann, wohl aber mit ihm einen gemeinschaftlichen Ursprung 
haben wird (} arab. J-ri^ ,zum Gefäss ausgehöhlter Kürbis' 1 ?) und 
ßoiöjo 1 arab. türk. pers. J^l>. Von den beiden georgischen Wörtern 
die noch mit der Bedeutung koöhocz verzeichnet werden, ist bo6o a 
ebenfalls arab. türk. pers., nämlich ^5^*° (eig. , chinesisches Porzellan'), 
und cr°J ^°; e^6j°6n, cmof^^o zwar als Bibelwort älter als die andern, 
aber doch gewiss dasselbe wie griech. XexavY], in der dorischen Form 
Xa*avY). Was das zweite Wort b^o^Fo anlangt, so will es der Verf. 
durch das alte und volkstümliche $ofc ersetzt wissen, dessen eigent- 
liche Bedeutung aber ,Glas' als Stoff ist (Staröewskij hat für CTaKaH^s: 
swan. huk, mingr. uupm, für CTeiMO : swan. mwiKh, mingr. uuko). 
Hierbei ist es aber unmöglich des gleichbed. cocab^o^o&o nicht zu ge- 
denken, welches auf pers. ^\SjLui^> zurückgeht; aus diesem ist auch 
das altruss. docmomm entlehnt, das dann in der späteren Gestalt 
cmamm noch einmal ins Georgische eindrang. Endlich neben dem 
dritten Wort b^cac^o stehen als gleichbedeutende lauter Lehnwörter: 
£)o&c^} lat. tabula, griech. TaßXa, arab. ^jU», türk. pers. *^>, ßfcaigbo 1 
griech. xpawe^a; 8^050 1 griech. por^c, -(ooq, arab. türk. pers. (*-)SjoU; 
b^a^a l arab. türk. pers. (a-yayUo, neugriech. aocppac; das oben erwähnte 
Ö^jo bedeutet im Mingr. ,Tisch', ebenso swan. ftoäo^. Der Verf. 
bevorzugt b^g&o; es bedeute zwar im Amerischen ,Tischtuch', im 
Imerischen aber .Tischt allerdings nur den langen, niederen, vier- 
füssigen; aber das Wort könne ja, wie in andern Sprachen, auf die 

verschiedenen Arten Tisch übertragen werden. Er scheint es nicht 

«4- ~° 

— 

-M - — 

Dies Wort bedeutet im Arab. und Türk. auch ,Korb'; daher wohl georg. 
t bQ&oG'o ; bg&o6Y>, br)3o6o, dass. 

2 Mingr. brjfTo, brjgETo, swan. boo^ (so nach Erckert, der auch ein mir sehr 
bedenkliches georg. sojno verzeichnet), tscherk. sehan, sahan ,Teller' weisen auf ein 
zweites Wort hin. 



t! öi 



■o 



03 



2 T5 

ifl tn 

£ -o 

-0 £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



366 SlLOWAN ÜHUNDADfE. 

als ein fremdes zu fühlen, während doch schon Orbeliani es als 
persisches bezeichnet, dem er irrtümlich allerdings als georgisch das 
(5^(mo gegenüberstellt; immerhin ist dies, da es in der Bibel das 
Wort für ,Tisch' ist, das älteste der genannten Lehnwörter. — Nicht 
immer kommt selbst ein echtgeorgisches Wort gegen das Lehnwort 
auf; so nicht im Sinne von ,Schlüssel' ^b^g&o (von ^c™)^ ,öffnen') — 
obwohl Bagajew in seinem Wtb. kjiwuz nur so übersetzt — gegen 
je?o(*)a> welches schon die Bibel kennt (S. 180), das aber trotzdem, 
wie mir scheint, nicht unmittelbar vom griech. y,Xs(q Akk. xXeTSa 

o 

stammt, sondern zunächst vom pers. ^i^ = arab. wX>Ji\ (t aus rf, wie 
z. B/in aiMoAo .Lehrer' } pers. ->U*o\). — Russischem Einfluss schreibt 
der Verf. die Ableitung weiblicher Substantive von männlichen ver- 
mittelst der Endung --> zu, wie 83030 ,Königin' von 83033 (S. 23); 
gewiss fallen solche Bildungen ganz aus dem Charakter des Geor- 
gischen heraus, aber sie treten weit früher auf als an jenen Ein- 
fluss gedacht werden kann, sind wohl zuerst griechischen Formen 
nachgeahmt — die Grammatik Antonis, welche selbst dem 18. Jhrh. 
angehört, bringt eine Reihe von Belegen aus dem A. T. (vgl. WZKM. 
x, 124. 313), darunter 83030. Auch im Baskischen finden sich ein paar 
Fälle von Motion zunächst in der Übersetzung des N. T. (vgl. meine 
Einleitung zu Leigarraga S. lxxvii). 

In der inneren Sprachform des Georgischen äussert sich nicht 
selten die Wirkung des Russischen ; der Verf. verpönt besonders den 
aus dem Russischen stammenden Gebrauch des Instrumentals und 



o ? 



gewisser Postpositionen in Wendungen wie ,mit Holz handeln', ,auf 
Bären jagen', ,mit Schlägen bedrohen', ,mit dem Leben zufrieden' 
u. a. (S. 156 f. 159 f.). — In andern Fällen in denen der Verf. einen 
russischen Einfluss annimmt, ist entweder ein solcher nicht nach- 
zuweisen oder nachzuweisen dass er nicht vorhanden sein kann. Das 
letztere wenigstens in einem Fall. Die Stellung der Konjunktion 
&o> ,als' (quando) nach dem Verb, welche bei den neueren Schrift- 
stellern sehr gebräuchlich sei, soll dem russischen Gerundium nach- 
gebildet sein, z. B. ^o>o OT ^^ &ö qU bo^9rj rv^ oKowmewu oaco dijo (S. 136 ff.). 
Das verstehe ich ganz und gar nicht; der Georgier wird doch sein 



> s 

£ ö. 

P 

ro ^ 
U 

O " 
> 

4-J 

1— 

> <u 

C CT 
=> O 

— o 

c O 

£ -o 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



LlTTERARISCHES GEORGISCH. 367 

fo nicht dem russ. Suffix -eiuu gleichsetzen? Die Hauptsache aber 
ist dass diese Stellung, die der Verfasser in den paar von ihm regel- 
mässig zu Rate gezogenen Schriften nur einmal entdeckt hat, ge- 
rade in der ältesten Litteratur, nämlich in der Bibel die gewöhnliche 

ist, Z. B. gb9o &o — °^O0 ctx C? ,i ^ ö — £ö&(oa9dgo(x>cicoo foo> Matth. IV, 12. 18. 

vni, 1. — Auch in gb ot<£) ob , dieser oder jener' = ,mancher< (S. 159) 
vermag ich nichts besonders Russisches zu erkennen; der Russe 
pflegt ja zu sagen momz u dpyeoto, und jene Verbindung kann überall 
von selbst erwachsen und dann auch aus ferner liegenden Sprachen 
welche sie besitzen, vermittelst der zahlreichen Übersetzungen 
Förderung erfahren (vgl. lat. hie et ille, ital. questo e quello und 
unser dieser und jener), während sie andern benachbarten und 
verwandten Sprachen fremd ist, die aber z. T. die entsprechenden 
Adverben ,hier und da', jetzt und dann' kennen. Auch das Geor- 
gische kennt *fo~o$ ,hier und da' = ,manchmal', und da sich der Ver- 
fasser dessen bedient (z. B. S. 127 Z. 6), so hätte er auch das qI> 
<»£) ob belassen können. Vielleicht kommt arm. >»j« &*- mju in gleichem 
Sinne wie letzteres vor: ich vermag es mit Bestimmtheit nicht zu 

-*- ° 

sagen, überhaupt hier die Möglichkeit armenischer Einwirkungen 

i_ i/i 

nicht gebührend zu erwägen; es wäre sehr verdienstlich wenn ein 
Einheimischer einmal die Übereinstimmungen in der inneren Sprach- 
form zwischen Georgisch und Armenisch erörterte. — Eine ähnliche 
Beurteilung muss der Gebrauch des Passivs anstatt des Aktivs, z. B. 
9cajc^«Qep^G'o anstatt Sca^o^ erfahren (S. 82 f.); hier ist gewiss nicht das 
Russische insbesondere vorbildlich gewesen (pbjjiz yöumz), sondern 
die Vorliebe für das Passiv ist eine gemeineuropäische Neuerung. Vgl. 
z. B. Wüstmann, Allerhand Sprachdummheiten 2 S. 94: ,Zu warnen 
ist nur vor der unter Juristen und Zeitungsschreibern weit ver- 
breiteten Gewohnheit alles passiv auszudrücken/ Der ungarische 
Ministerpräsident Bänffy bevorzugte im Magyarischen das Passiv, 
welches aber unsern neuarischen Passiven ganz unähnlich ist, der- 
gestalt dass die Witzblätter sich über ihn lustig machten. Man nehme 
hinzu was Miklosich in seiner slawischen Syntax (S. 740) sagt: ,Die 
den europäischen Sprachen analoge Ausdrucksweise drängt die eigen- 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frann 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

— 

ü Q_ 



F p. 



u 

O <L> 

CT 



368 SlLOWAN CHUNDADfE. 

tümlieh slawische immer mehr zurück, eine Erscheinung die sich 
auch in andern Sprachen unsers Weltteils beobachten lässt; denn 
ein gewisser, man möchte sagen, Europäismus strebt die Sprachen 
der an der Kultur teilnehmenden Völker Europas wie zu einem Idiom 
zu vereinigen/ Es ist nun aber zu bemerken dass den Georgiern 
von allem Anfang an das Passiv näher gelegen ist als das Aktiv (vgl. 
meine Abhandlung Über den passiven Charakter des Transitivs in 
den kaukasischen Sjwachen S. 55 ff.); das Verb an sich hatte ur- 
sprünglich passiven Sinn, und den zeigt noch das Praet. n mit 
dem Aktivus zur Bezeichnung des Subjekts. Einer zweiten Schich- 
tung gehören das Praet. m und iv an mit dem Dativ als Subjekt 
und mit passiver Prägung des Verbs: ^-^q6o-ö gleichsam ,ihm ge- 
schrieben ist' = ,er hat geschrieben', aber bei gewissen Verben noch 
mit einer Form die sich von der aktiven nicht unterscheidet: 3cm- 
jcmagb ,er tödtet', 3ca-«Q-jfm^^ ,ihm getödtet ist' = ,er hat getödtet'. 
Ferner trat neben jenes Praet. n, dessen passiver Sinn verblasst war, 
ein neues durch den Vorvokal ausdrücklich als passiv gekenn- 
zeichnetes Praet. n: in der Konstruktion aber besteht zwischen 
beiden kein wesentlicher Unterschied: 9ca-jcwo joqo 3go)g-9 = Sca-o-jc™* 
jc>qo 3Qoj-obg > o6' ,getödtet ward der Mann von dem König — seitens 
des Königs/ Das neuerdings aufgekommene 9wLjc5?geK )" 3^ welches 
vollkommen unserem ,getödtet ward' entspricht, vertritt demnach 
nicht sowohl Scajcmgb ? sie tödteten (ihn)' als 3c* - o - je™'* : das mit 
dem Hülfsverb zusammengesetzte Passiv das einfache. Die Um- 
schreibung kann durch das Russische oder durch westeuropäische 
Sprachen angeregt, aber auch auf georgischem Boden selbständig 
gebildet worden sein. Eine gleiche Unsicherheit fühle ich mit Hin- 
sicht auf .eine noch merkwürdigere Umschreibung, die wie ich glaube, 
nur der neueren Zeit angehört, über die ich aber von Georgiern 
selbst nähere Auskunft zu erlangen wünschte. Wir finden nämlich 



ti öi 



w i 

fN «/) 

, O) 

^ U 

° m 



o E 



§ s 



F p. 



u 
o <u 

■4-J ±1 

sehr häufig das Part. Pass. Praet. mit ,haben' in demselben Sinn 



verbunden wie bei uns; z. B. ^gb Sqq^c™ ,er hat gegeben'. Russi- 
scher Einfluss ist hier natürlich ganz ausgeschlossen ; westeuropäischer 
aus äusseren Gründen nicht recht begreiflich. Innerhalb des Geor- 



> <u 

=) o 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Litterarisches Georgisch. 369 

gischen mochte zwar z. B. j^o 9oaj^Qojocnnn ^3(00 von der Bed. ? er 
hatte ein Heer als gesammeltes' leicht zu der: ? er hatte ein Heer 
gesammelt' vorschreiten; aber ; er hat einen Becher als geschenkten' 
hätte doch eigentlich nichts anderes werden können als : ? er hat 
einen Becher geschenkt bekommen' und nicht, wie es nun eben 
der Fall ist: 7 er hat einen Becher geschenkt'. Und ich lese ja in der 
Tat z. B. oa&coc>3Qb koQoaQbcmfl ' ^l> 3o6o&]&<c)e™ ,beide [Tier und Mensch] 
haben das Leben geschenkt' = ^geschenkt bekommen', was auch, dem 
Wortlaut nach, so viel sein könnte wie ,haben [andern] das Leben 
geschenkt'. Dass nun im Georgischen das Verb welches den Besitz 
bezeichnet, ebenso wie im Romanischen und Germanischen, die mit- 
einander in Fühlung standen, und im Baskischen, das sich hierin 
nach dem Romanischen richtete, als einfacher Ausdruck der voll- 
endeten Handlung verwendet wird, erscheint allerdings wunderbar; 
und doch lehnt sich diese zusammengesetzte Zeit an eine andere 
des Georgischen an, nämlich an das Praet. in. 1 Es muss nämlich 
berichtigt werden dass , haben' strenggenommen im Georgischen nicht 
besteht; es wird ersetzt durch zwei Verben welche bedeuten ,(im 
Besitz) sein' und von dem für das prädikative ,sein' sich unter- 
scheiden: a^gb (von Dingen), a^b (von Personen) ,mir ist' = ,ich 
habe'. So entsprechen sich z. B. 6^60 S-^b und 9o-^&o-o ? ich 

habe geschrieben' in Form und Sinn zwar nicht völlig, aber doch im 

^ <-> 

wesentlichen. — Zwei miteinander eng verknüpfte Eigentümlich- 
keiten des Georgischen, über die- sich der Verf. S. 126 ff. auslässt, 

O ö 

verlieren vor dem Europäismus mehr und mehr an Boden. Am 
Schluss einer Anführung die von irgend einem Verb des Mitteilens 
begleitet ist, wird dies in einer allgemeinen und abgekürzten Form 
wiederholt um etwa die Bedeutung unserer Gänsefüsschen zu be- 
kommen (1. P.: -3 a^o, 2. P.: -^cn., 3. P.: -^), z.B. im Deutschen 
gleichsam: , „wohin gehst du, sagte er?" fragte er mich'. Die indirekte 






F P. 



«4- ~° 

O <L> 

*s 

'i/i öi 



z> 



o 






03 



fU 



1 Auch das Neugriechische kennt dies zusammengesetzte Perfekt: ^w ypafJ.- 



pivo; daher hat es wohl das Lafische entnommen: v^ömin 3oq">«£)6\ Stammt nun 
etwa wieder aus dieser Quelle das georg. ^q^oc^o 3o^ßb ? Es wäre hierfür wichtig 

zu wissen ob das Mingrelische an dieser Erscheinung teil hat; 

S "ö 
-0 £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



370 Silowan ChundadIe. 

Rede pflegt der Georgier durch die direkte zu ersetzen, z. B. auch 
in solchen Fällen wie ,er hoffte dass er ihn sehen würde'; dafür 
heisst es: ,er hoffte, „ich werde ihn sehen, sagte er'". Es verhält sich 
also gerade umgekehrt wie der Verfasser meint: die direkte Rede 
stehe dem Georgischen nicht an; durch die angegebenen Anhängsel 
wird ja die Rede nicht zur indirekten. Dieser Gegenstand aber 
bedürfte einer gründlichen Darstellung; wenn heutzutage die Über- 
einstimmung mit unsern Sprachen sich anbahnt, so ist nicht zu über- 
sehen dass sie eigentlich schon in der ältesten Litteratur, nämlich in 
der Bibel vorhanden war. — Mehrfach begegnen wir im Georgischen 
Schwankungen oder Entwickelungen die uns eben deshalb interessieren 
weil sie neue Belege für bekannte Erscheinungen sind. Das prädi- 
kative Personalpronomen (,wenn ich du — er wäre') wird von den 
Sprachen die einen Prädikatskasus haben, in diesen gesetzt (z. B. 
magy. ha en neked volnäk, poln. gdybym byl toba), aber auch von 
mancher andern nicht in den Nominativ (z. B. ital. se io fossi te, 
holl. als ik hem was). Das Georgische besitzt einen Prädikatskasus, 
den Adverbial, auf ->e?; aber es gebraucht ihn nicht von der 1. und 
2. P. (wenn ihn auch die Grammatiker mit Ausnahme Zordanias in 
diesen Paradigmen anführen), sondern statt dessen entweder den 
Nominativ (so in Imerien): 9q &m8 ^6" go^ca, oder den Genetiv: 3q 
<W3 ^Fo go^jca ,wenn ich du wäre' (S. 157). Der Verf., der das 
letztere missbilligt, meint, es bedeute ja soviel wie ,wenn ich dein 
wäre' d. h. ,dir gehörte'; indessen handelt es sich hier nicht um 
einen possessiven Genetiv, sondern um einen ähnlichen wie wir ihn 
haben in ,zufrieden mit', ,dankbar für' (s. S. 156 f.), ,sich fürchten vor', 
, glauben an' (Pass. Char. S. 68 f.), und wie er nicht mit £ordania 
(d°<W fcfc. S. 127 § 64, oö) aus einer Ellipse zu erklären ist. Wie 
verhält sich das Georgische mit Bezug auf die prädikative 3. P. 
(auch £ordania verzeichnet o9:>co)? — Dem Verfasser zufolge (S. 158) 
wird in Amerien gesagt a^bco <joao&a£a ,er wusch sich die Füsse', in 
Imerien aber gQbo ejoo&ofo u. ä., und das sei das Bessere; denn die 
pluralische Darstellung eines allgemeinen Begriffes entspreche dem 
Charakter des Georgischen nicht, wie er schon früher (S. 154) be- 



t; öi 



"ö 



.TD 
ö> 



F P. 



u 

«4- ~° 

O <L> 



'öl 

CD 



ö 

c 
— o 

CO 

_£ % 

w tn 

£ -ö 
-ö v 

E-e 

E => 

fD O) 

I • 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Litterarisches Georgisch. 371 

merkt habe. Aber hier hatte er die neuerdings vorkommende Bil- 
dung von Adjektiven aus Pluralen gerügt, wie b^enn^m ^oaGVboo 
,Mädchengymnasium' für bo^oemca ^. ; die ja in der Tat ungeorgisch, 
aber auch unsern Sprachen fremd ist. Hier jedoch handelt es sich 
um die Bezeichnung paariger Körperteile, bei welcher die einen 
Sprachen den Singular, die andern den Plural bevorzugen. Es 
scheint mir dass vom Deutschen, wo ja auch Fuss, Auge für Füsse, 
Augen gesagt wird, das Georgische sich nicht wesentlich unter- 
scheidet, wenigstens nicht soweit ich die biblischen Stellen vergleiche. 
Die meisten der vom Verfasser angeführten Fälle in denen besser 
der Singular als der Plural zu setzen sei, sind solche in denen der 
Plural überhaupt keine sachliche Begründung hat, wie b^o^a) ^jatT = 
boQooe^b wj. ,nach der Mahlzeit', <2)o6co ^oq^o — ^obocoo = ö^q ß. — $. 
,er zog sich an — aus'. Man bemerke den Wechsel der Kon- 
struktion in diesen letzten Beispielen: ,den Leibern' — ,auf dem 
Leib'. Ich glaube dass dieses -o> ein analogisches ist, wohl zunächst 
in Zusammensetzungen wie $ö6a)-böQ9gemo auftretendes, etwa unserem 
•s in Geburtstag, Hülfsmittel zu vergleichen. — In den Sprachen 
die das prädikative Adjektiv (oder Partizip) in der Regel unverändert 
lassen, äussert sich öfter die Neigung es mit dem Subjekt in Kon- 
gruenz zu setzen; so schwankt das Baskische, nach Ort und Zeit, 
zwischen ,der Mann ist gut', ,die Männer sind gut', wie es wohl von 
Anfang an überall geheissen hat, und ,der Mann ist der gute', ,die 
Männer sind die guten'; so wird heutzutage im Deutschen oft gesagt 
und geschrieben: ,der Erfolg war ein ausserordentlicher', ,die Ein- 
nahmen waren sehr gute', mit unbewusster Annäherung an vor- 
zeitlichen Gebrauch. In diesen Fällen ist die prädikative durch die 
attributive Verbindung beeinflusst worden; und ebenso wird es sich 
im Georgischen (welches Geschlecht und Artikel nicht kennt) ver- 
halten, wenn z. B. neben gb j^qq&o &&8ö 0^006" , diese Menschen sind blind' 

Ei — 

gesagt wird q. j. &63rj&o 0&006". Wir brauchen das letztere nicht zu 






F P. 



cn 



fassen als , diese Menschen sind Blinde' (wie , diese M. s. Toren' u. s. w.) 
und nicht mit dem Verf. (S. 121) die Regel zu schmieden dass das 
Prädikat wenn substantivisch verändert werde. — Der nicht seltene 

c "ö 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 25 

o "E 
E => 

to _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

o3 £ 

C _Q 

ü Q_ 



Original frorn 



372 SlLOWAN CHUNDADfE. 

Gebrauch des Nominativs statt des zeitlichen Dativs neben den per- 
fektischen Formen, z. B. # ^M* oß g&o>o jQobo ,er blieb dort eine 
Woche' statt g&cn j^o^öb (S. 152) beruht auf einer Verwechselung des 
eigentlichen Dativs mit dem akkusativischen Dativ, der neben dem 
(passivischen) Perfekt durch den Nominativ ersetzt wird. Die Ver- 
wechselung liegt nahe; es ist als ob man sagte la semaine qu'il est 
restee lä, was vielleicht irgendwo im Romanischen vorkommt. — 
Zwei wirkliche ,Sprachdummheiten' finden sich S. 194 f. besprochen; 
sie sind aber doch nicht b^gcjo^c? a^M^fco. Wenn Sb^e^^n für 
b^gcnrv/^o ,Unterrichteter' gesagt wird, so hat sich das 3- des Part. 
Praes. S^b^g^mgcmo ^Unterrichtender' eingemischt, und das wird nicht 
befremden wenn man bedenkt wie gern diese beiden eigentlich gegen- 
überstehenden Begriffe zusammen gerückt werden: Gelehrterem Lehrer, 
doctus (v doctor, scholaris engl, scholar, lernen für lehren u. s. w. Auch 
bei amer. (schon bei S.-S. Orbeliani) gßg8fcoa> = &^3oa> , still' lässt sich 
die Aufhebung des Gegensatzes erklären; das erstere bedeutet nicht 
sowohl ,un-still' als ,ohne Mucks' (das -&- macht keinen Unterschied, 
es ist das partizipiale; * ßg3&o = 36^3^, wie 3co^3^o = 3(o^3^g ,still') 
ß<g3o ist nicht bloss ,lautlos', sondern auch ,leise'; vgl. lat. mussare 
,leise reden' und ,schweigen'. ,Nicht-leise' kann sein: ,nicht bloss 1.' = 
.laut' und ,nicht einmal 1.' = .lautlos'. — S. 163 ff. stellt der Verf. 
dreissig unrichtige Redeweisen mit ihren Verbesserungen zusammen, 
ohne sie im einzelnen zu erörtern. Sie sind ihrem Ursprung nach 
sehr verschiedenartig. Gewiss wird oaobe^ob 3 &c>b regelrechter sein 
als üOü^cr C) ^°^ (13); doch sehe ich in dem letzteren eine altertüm- 
liche Bildung, wir haben ja auch OOO^CT^ ^er^o = ^03000^° >Feuer- 
nelke'. Für a<>ß<)&e°ok ,sie kehrten ein' (im Gasthof) solle man sagen 
fic>3oab<2)3& ( 7 )- I n der T at bedeutet (^)&o^ü^ zunächst ,gaffen', ,ver- 
blüfft sein' und ist offenbar eine lautliche Variante des gleichbed. 
(a^P^ü^ü^ (vgl. fo- J ^od^-); wenn es sich auch nicht absehen lässt 
wie es zu der andern Bedeutung gelangt ist, so scheint doch ein 






■o 



03 






F P. 



<u 



TD 



=) O 



interner Vorgang angenommen werden zu müssen. Übrigens frage 



ich ob hier nicht fioSoabögf)' zu ersetzen ist durch ßoSrabcoQG" (oder nach 
der Schreibung des Verf. RöScabcojjf ) ; f^3oabcooa3o ist nach Tö. 2 ,ein- 

£ -o 
-0 v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



LlTTBRARISCHES GEORGISCH. 373 

kehren', ,sich auf halten' (mit dem Faktitiv foSoabcof)^), fio3oab<»)oa3a : ,herab- 
springen' (z. B. vom Pferde). Freilich findet sich hier auch unter 
dem letzteren die Bed. , einkehren', wie umgekehrt bei Tg. 1 unter 
fic>9oabeooa9c> auch ,(vom Pferde) absteigen'; die beiden Verben scheinen 
also schon seit längerer Zeit miteinander verwechselt zu werden. 
Manche von den gerügten Ausdrucksweisen trägt einen ganz all- 
gemeinen Stempel, so <goboa> für fo$ocnzcn ,zu Fuss' (24), wo auch das 
Russische und Armenische, sowie das Magyarische und andere 
Sprachen besondere von dem Wort für ,Fuss' abweichende Bezeich- 
nungen haben. In andern Fällen liegt der fremde Einfluss zu Tage, 
und einmal weist der Verf. darauf hin. Einer russischen Wendung 
(die mir übrigens nicht bekannt ist) soll ^fincn b^bg ,voll von 
Fülle' = ,ganz voll' (17) nachgebildet sein. Wir sagen: ,hängen an' 
und , abhängen von', entsprechend der Russe: eucbzab na und 3aeucimb 
omz. Der Georgier gebraucht beide Male die Postposition -^(e?) 
,auf, demnach ist e° ö 9^j°e°o& t C)e^ ß^ofT ein Russismus für co- fy)^ 
,es hängt von mir ab' (4). Sehr auffällig ist bofy^^Wferjco für baß«^™» 
,in Eile' (16) r\j mcKopo. In armenischem Munde erklang wohl zuerst 
foo c?o6b? für ^cagjca^ (no&b? ,was kostet es?' (l) rvj fi%i_ u*pJ-k und 
^ö3corj6'o b^ooö? für ^caSgc^o bv>oa)no? ; wie viel Uhr ist es?' (ll) r^> J-wJk 
j>tu%f k\ in baoooob ca^>oö für nAo b^ax^ ,es ist zwei Uhr' (ll) ist die 
Wortstellung armenisch. Wie jemand dessen Müttersprache das 
Georgische ist, c^b und 303b (10. 30) miteinander verwechseln kann, 
ist schwer zu begreifen. 

Die Mehrfachheit der flexivischen Formen zu erklären dazu 



■0 






■o 






fD 



bedürfte es grossenteils sprachgeschichtlicher Erörterungen die all- 
zuviel Platz einnehmen würden. Man könnte z. B. die Zusammen- 
kuppelung der beiden allgemein gültigen Pluralendungen -60 und 
-fl&o zu -6"-g&o oder ~cj6-So (vgl. S. 22) für eine ganz junge Erscheinung 
halten, wenn wir nicht im Mingrelischen von den auf -a endigenden 



fD 

F P. 



u 

«4- "ö 



> -43 

Substantiven entsprechende Plurale fänden, z. B. 5fco9ö-<m-ggo, georg. 






d9ö-6"^J)o ,Brüder'. Allerdings ist -c^o als selbständige Pluralendung 

<D 

im Mingrelischen nicht mehr vorhanden; wohl aber kennt das Swa- 
nische -(<>)c™ als solche und zwar neben -o<r>. Auch diese beiden 



I I 25* 

o c 

E => 

fD <D 
w .c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



374 SlLOWAN CHUNDADfE. 

Endungen, die wohl nur lautliche Varianten sind, verbinden sich hier 
zuweilen, z. B. a a -<m-öfc ,Väter'. Wiederholung der ganz gleichen 
Endung haben wir im georg. jafc- a &-g&o neben j^- a io ,Türen'; aber 
das rührt offenbar daher dass j*fc a 2>o auch Singularbedeutung hat, 
eig. ^zweiflügeliges Tor' (vgl. russ. eopomd), dann aber wohl ,Türe' 
schlechtweg (so bei Erckert; und mingr. j^ggo für ABepL bei StarC). 
In der Bibel finde ich ebenso kfoGo statt ^ = tojXy), icuXciv, topa. — 
S. 161 zählt der Verf. eine Reihe von Fällen auf in denen für die 
Mehrheit (des Objekts oder Subjekts) ein anderes Verb gebraucht 
wird als für die Einheit so .das Glas zerbrach': e^ögc?^ ,die GL 
zerbrachen': (©aoS^fca — ,das Kind setzte sich': e^&c^; ,die K. setzten 
sich': coöl)b<5 a £ — ,die Quitte fiel herab': Ro9ci 3 dfc<s* 5 ,die Qu. fielen 
herab': Rö9piQ 3 o£(oa. Das mittlere Beispiel lässt sich unsern mehr- 
• stämmigen Verben, wie je vais — nous allons vergleichen ; meistens 
jedoch wird ein begrifflicher Unterschied gefühlt werden (etwa wie 
wir sagen: ,es fiel ein Stein'; ,es regnete Steine'), und so haben 
wir hier wohl einen atavistischen Zug des Georgischen zu erkennen, 
den die mit eigenem Suffix gebildeten Pluralitätsverben des Swani- 
schen (auch andere kaukasische Sprachen weisen solche auf) stärker 
hervortreten lassen. — Die sehr zahlreichen Schwankungen inner- 
halb der Konjugation welche der Verf. bespricht, aber gewiss ohne 
sie zu erschöpfen, sind teilweis erst in neuerer Zeit entstanden; 
doch auch dann ist nicht immer die zu Grunde liegende Anähnlichung 
oder Verschmelzung leicht aufzudecken. Sehr merkwürdig ist das 
Verb ocnbofy&ö ,bekennen' (S. 92 ff.); zunächst in dieser schon der 
alten Sprache angehörigen Infinitivform. Man sollte erwarten: öfnafcg&o, 
wenngleich ein Verb zbfio, das etwa ,sagen' bedeutet haben muss, 
nicht mehr nachzuweisen ist; wie sich das Präfix bo- aus den Parti- 
zipien hat einstehlen können (TS. 1 schreibt wirklich ^b^fy^), weiss 






T3 



1 (ü 
O o 



F P. 



u 

- O) 
_N 
'-I-J 

'Ol 

> 

"c 



ich nicht. ,Ich bekenne' heisst ötrj-g-o-öfyjfc, ,ich bekenne ihm': ^-3-y- 
öfyjfc. Es kommt nun im Georgischen vor, wenngleich nur ausnahms- 
weise, dass ein dem Stamme vorausgehender Teil der Verbalform 

o 

mit ihm fest verschmilzt. So das Zeichen der 3. P. im Dativ in 
g^jg&o =^jq2k>; mingr. 6(^060, laf. caß^oPg , wissen'. Das ist ursprünglich 

in i/) 

.£ -o 
-0 v 

E-e 

E => 

fD O) 

to _c 
in +j 



Original from 



1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Litterarisches Georgisch. 375 

und im Mingr.-Laf. noch ein unpersönliches Verb: 8oß^g, ybfa — 
aofi^oG"; £j&3°^; > es ^ m * r > ihm bewusst (bekannt)' = ,ich, er weiss 
(kenne, -t)'. Georg, *o^ob ,er weiss' wurde persönlich gefasst (Ahnliches 
im Bask.), und dazu g-£)^o ,ich weiss' u. s. w. gebildet; faktitiv: ga- 
•g^gk. Die Möglichkeit dass ein Substantiv ' ganz mit dem Verbal- 
stamm zusammenwächst, veranschaulicht uns der Verf. selbst S. 121 
mit seinem gobge^Sd^g^Gge^oao), während er unmittelbar darauf richtig 

schreibt: bgc^gQcl^go&gennoT&oo. In dem oben genannten Verb ist zunächst 
<* 

der Charaktervokal -o- zum Stamm gezogen worden (einen Infinitiv 
i^ 

oenoofy&o verzeichnet T§. 2 ), und sodann auch die Präposition oqo-. Aber 

dabei ist man nicht von der 3. P. S. omoo&gfcb ausgegangen, sondern von 

der 1. P. S. OQnr)oofy)& und ist so zu goc»goo&g2> (das also nichts mit der 

Wiederholung des 3- in 3ogcoogo& u. s. w. gemein haben würde) 

0^300^3^ oQvjoo&g&b u. s. w., Inf. oQv^&g&o gekommen. Ich vermag 

mir das nur daraus zu erklären dass das Verb eben in der 1. P. S. 

am allerhäufigsten ist, und zwar als laut gesprochene Formel, sodass 

die 3. P. S. gleichsam den Sinn hat: ,er sagt: ich bekenne*. Ein 
■^ 

solches omoooMb mit dem 3- der 1. P. Hesse sich im Deutschen 

-c g 

etwa durch ein scherzhaftes ,er pater-peccavi-t' nachahmen (über 
derlei Umgriffe der 1. P. S. der Verben s. meine Roman. Etym. 1, 9). 

in ^f. 

Das Georgische ist zu dergleichen am ehesten befähigt, insoweit es 
die indirekte Rede verschmäht. So gilt auch ßg3g<!^ (von 6380 ,mein') 
soviel wie oogobg&o ? sich aneignen'; oßg9g&b ist eig. = ,er sagt: es ist 
mein'; beides wird dann auch (^g9g?>b ; </»pgobg&b) für e?oo9obg&o (von 
o3obo ,sein') gebraucht, und die entsprechende Erweiterung eignet dem 
russ. y-, upuceoueamb. In unsern Sprachen fehlt es nicht ganz an 
Parallelen; vgl. sein Egoismus. — S. 89 f. untersucht der Verf. ob 
man 3o<r>^gg>> oder 3o^ggo zu sagen habe, und entscheidet zu Gunsten 
des letzteren ; das -ej- habe gar keine Berechtigung. Allein es 
handelt sich hier um zwei verschiedene Verben die in der Bedeutung 

"ö\ .CT 

zusammenstossen und vielleicht sich beeinflusst haben; nur ist 9ob^ggo, 



cn 



wie der Verf. in Klammern setzt, die richtige Schreibung des ersteren. 
Das einfache Verb lautet eigentlich bfc^gga, dann, mit der so gewöhn- 



03 



fU 



liehen Tilgung der interkonsonantischen fc: b^gg«>. Orbeliani glossiert 

.E "o 
-o v 

E-e 

E => 

ro <V 

to r 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



376 SlLOWAN CHUNDADfE. 

es, gewiss unzutreffend, mit (o^ü^a^ und go^qGq^, die beide inne- 
halten' u. ä. bedeuten, TS. 1 übersetzt es mit tibipyiamh, ujöaejuiazi, 
T§. 2 mit docmmaufb, doxoduuu, und ähnlich in den Zusammen- 
setzungen, aber e?^03° wie TS. 1 wiederum mit eupyuamb, zoöaeJinmb. 
Orbeliani setzt hierzu Qo^em^ (,zerstören* — ,entfalten') ; aber der 
Herausgeber merkt verbessernd dazu an: ooogob ^o^^ob^ojcro^ (das 
ist U3Öaejinmbcn). Ich vermute dass das Verb, auch mit dem Cha- 
raktervokal ->>-, nur intransitive Bedeutung hat: ,(von irgendwo oder 
irgendwohin, mit Mühe) gelangen', ,sich retten' u. ä. (nicht ,retten'). 
In einigen Zusammensetzungen finde ich für und neben -b^gg* mit 
Umstellung: -bgg^; dann allerdings hat -a- faktitiven Wert, und ausser- 
dem entspricht dem -b^ggo ein -bgg^g&o. So bei T§. ^^q^q^ 
= fc^eo^^gg ,ich lasse entkommen', ^^bgg^ dass. (aber ^^gg ,ich 
entkomme'). — Manches ist mir so rätselhaft dass ich nicht ein- 
mal eine Vermutung darüber äussern kann, so das b von b^o^ogo = 
a o <?3° (S. 87); denn warum sollte das b welches als Zeichen der 
3. P. sich vor den mit einem Dental anlautenden Verbalstämmen 
erhalten hat, sich ausserdem in einem einzigen Falle vor ^ nicht 
erhalten, sondern erst in späterer Zeit wieder eingefunden haben? 
Vielleicht ist es aber besser dass wir diese einzelnen Probleme so- 
lange zurückstellen bis wir über die allgemeinen Punkte der geor- 
gischen Konjugation noch grössere Klarheit gewonnen haben. Wir 
sind selbst über das Tatsächliche noch ungenügend unterrichtet, 
z. B. über die Bedeutung der Charaktervokale. Die nicht ganz 
wenigen Darstellungen des Verbs die von Einheimischen herrühren 
(auch CHUNDADfE hat uns eine solche, und recht empfehlenswerte 
gegeben: ^a&cov»)£T>o ^Gq&o — d9. ^oc^odgor>o ft^^üü^ 0, ^tD 0000 ^ Tyno- 
•/lHTorp. H. H. TaMpeKC/iOBa bi> KyTaHci. 1891) könnten uns noch 
mehr fördern als sie tun, auch ohne den beschreibenden Charakter 



CÜ 






w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o E 



F P. 



u 

«4- ~° 



l ) 



zu verlieren und den Unterrichtsz wecken untreu zu werden. 

Die Rechtschreibung, i^om^^ (der Verf. braucht das Wort 

ganz in dem weiten Sinne wie wir ,Orthographie', das wir ja oft 

" ° 

mit dem Attribut .falsch' versehen), welche für den Festiger und 

Richtigsteller der Sprache ein sehr wichtiges Kapitel bildet, ver- 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Litterarisches Georgisch. 377 

anlasst eine oberflächliche Betrachtung der einzelnen Laute. Diese 
ist recht wunderlich ausgefallen. Es heisst S. 95 f. dass von den 
Konsonanten einige den Eindruck machen als ob man mit den 
Füssen auf die Erde stampfe oder in der Ferne schösse ( ? hart und 
grob'), andere als ob Gläser aneinanderstiessen oder man mit einem 
Stab an ein kupfernes Becken schlage (,hart und fein'), andere 
wiederum als ob Wasser hervorsprudele oder man auf Schnee, Watte, 
Schlammwasser einen platten und leichten Gegenstand auffallen lasse 
(,weich und grob'). Soviel ich sehe, rührt der Unterschied zwischen 
,groV oder ,dick' (9cn.9bbc*x oder 1^30^0) und ,fein' (^806^0) vom Verf. 
her; man begreift was gemeint ist z. B. bei $ und ^, ^ und l>, aber 
kaum bei e° und $, 3 und 9. 1 Den andern Unterschied zwischen 
,hart' (Sog^o) und ,weich' (&&oc»n) hat schon TSubinow (welcher für 
den ersteren Ausdruck Söj^qq gebraucht) in seiner georgisch ge- 
schriebenen Grammatik S. in aufgestellt, wo aber die Sache durch 
mehrere Druckfehler recht unklar gemacht wird. Über die Tenues 
und die Affrikaten kann kein Zweifel obwalten: die mit Kehlkopf- 
verschluss gesprochenen sind ,hart', die mit offenem Kehlkopf ge- 
sprochenen ? weich'; nach unserer Auffassung sind auch die Mediae 
,weich', und ausdrücklich wird von T§. 2> so bezeichnet, o? aber als 
,hart', von $ ist nicht die Rede. Der Verf. zählt die Mediae zu den 
,harten' Konsonanten und schreibt daher, in Befolgung der schon 
bei TS. sich findenden Regel ,hart mit hart, weich mit weich', (3°* 
und bo) auch da wo gewöhnlich qco und b^o geschrieben wird, z. B. 
T^qox^ 9cabo)o. Tg. gibt a. a. 0. unter den Beispielen dieser Regel: 
,£)goenr>obo oder coooemobo und nicht ßkoe^obo oder cogoc^obo' ; aber in 
der ersten Form haben wir jedenfalls ,hart mit weich' und in der 
vierten jedenfalls , weich mit weich'; die zweite würde dem Verf. 
zufolge nicht zulässig sein, wohl aber die dritte. Da 3 immer nur 
mit ,harten' Tenues sich verbindet (z. B. Praes. 30^30^ aber Perf. 
3°°^3°); so durfte es schon aus diesem Grund nicht unter die , weichen* 
Konsonanten gestellt werden (vgl. Über das Georgische S. 11). Eine 



t! öi 



w I 

fN CO 

f\l ^ 

, CD 

° £ 

O o 

c v> 

o E 



CD 



F P. 



u 

«4- ~° 

O <D 

*S 

■h! ■— 
'i/i öi 

CD ? 

> CD 

C CT 

=) O 

— o 

c O 



1 Nur aus Versehen ist gewiss J unter die ,groben' Konsonanten gekommen. 

.E -ö 
-0 v 

E-e 

E => 

fD CD 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

CD ^ 

C _Q 

CD 3 

ü Q_ 



Original fronn 



378 SlLOWAN CHÜNDAüfE. 

andere Regel welche der Verf. auftischt, ist die dass im Stamme 
eines Wortes nicht zwei Laute desselben Organs aufeinanderfolgen; 
das ist richtig nur für die Mediae und Tenues, und beruht insoweit 
auf allgemein physiologischen Gründen; den labialen Nasal 9 nimmt 
er selbst davon aus, und so hätte er auch F davon ausnehmen müssen. 
Allein er erkennt hier den dentalen Nasal nicht, wie denn die Ein- 
teilung nach den Artikulationsstellen bei ihm ganz unvollkommen ist. 
In Bezug auf Einzelnes möchte ich noch ein paar Bemerkungen 
machen. S. 81 sagt der Verf., welcher im allgemeinen die Doppel - 

o 

konsonanten verpönt, man müsse b^bbo>^> schreiben, das eine b ge- 
höre dem Verbalstamme, das andere dem Hülfsverb an. Verhält es 
sich mit tcn^f nicht ganz ähnlich, wofür er immer tn^f schreibt? 

6 

— S. 191 handelt der Verf. von den beiden Sprechweisen q<]o9o und 

r--> 

0^080 ,Arzt'; die Schwankung erkläre sich daraus dass im Persischen, 
woher das Wort stamme, ein Mittellaut zwischen und n gehört 
werde. Vielmehr kommt die türkische Aussprache heklm des arab. 
r£** * n Betracht. — Auch jo9J>r|ßo und j^q&o ,Büffel' (S. 193) werden 
einen etwas verschiedenen Ursprung haben; in jenem und seiner 
Nebenform j^k^o (daher oss. thusch. kambeU, abch. kanba§) ist mb 

I in 

umgestellt aus vm des pers. gävm.U 7 dessen Kollektivform gämes 
in dem andern durchscheint. — S. 197 hält der Verf. 3 ^3ÜCT 
,Ameise', welches von 5° ö ,Wurm' herkomme, zwar für die regel- 
rechte Schreibung, gibt aber doch der andern s^oß^^o den Vorzug, 
weil das Georgische die Aufeinanderfolge der gleichen Konsonanten 
in einem und demselben Wort vermeide und die letztere Form in 
ganz Imerien und auch grossenteils in der Litteratur herrsche. 
Hiervon ist nur das richtig dass ^o^oc^ das beste Zeugnis für 
sich hat, welches Erwähnung verdient hätte, nämlich das älteste, die 
Bibel. Was ä oc, ^30CT o betrifft, so ist es erst durch Einmischung von 
^oo aus dem vom Verf. gar nicht angeführten ^^ÜCT entstanden, 
welches vielleicht die ursprünglichste der drei Formen ist. Die 






U 

_N 
'-I-J 



Ameise wird nämlich gern mit einer Reduplikationsbildung bezeich- 



=> o 

' o 



net, die das Wimmeln oder Kribbeln der Tiere nachahmt: später 
£ 3 / m ' r 

tritt dann nicht selten Dissimilation in der ersten oder der zweiten 

.E -ö 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Litterarisches Georgisch. 379 

Silbe ein ? so gr. [Auppnqä;, [i.6p(jto; : ßöpjxa^ lat. formica, ir. moirb u. s. w. 
So finden wir in den kaukasischen Sprachen: awar. t s f unt 8 f ra, thusch. 
t'ant\ abch. sgskams, mingr. HKUuzumia, dMsudowzumia, laf. dund^u, 
diniko (ich bin genötigt die Schreibung der Quellen wegen ihrer 
Zweideutigkeit unverändert zu lassen); das swan. Mt/puiK, MOpuiK, 
Mbiiux scheint aus dem Ossischen (muld z ug) entlehnt zu sein. Wenn 
B o %0cr o (°der -*) wirklich zu ^ofT^ge^ (oder -o) geworden ist, dann 
spielt jenes vermeintliche Wohllautsgesetz gar nicht mit; auch ist ja 
die Lautfolge § — $ sehr häufig im Georgischen. Ganz ähnlich mag 
es sich mit j£o6$c>£>o = ftotyzbo ,Nessel' verhalten; das höhere Alter 
der zweiten Form scheint mir durch mingr. <3ra3flcrQ verbürgt zu 
werden. 

o 
o 

Man wird aus dieser Besprechung ersehen nicht nur wieviel 

ich aus dem Buche gelernt habe, sondern auch wieviel ich über die 

gleichen Gegenstände noch zu lernen wünsche. Möchten doch die 

Georgier ein wenig auf die Wünsche und Anfragen eingehen welche 

ein bescheidener Fremder hinsichtlich des Tatsächlichen ihrer Sprache 
■^ 

an sie immer von neuem richtet, sie welche den Fremden für das 

-c g 

ihrer Sprache und Litteratur erwiesene Interesse so dankbar zu sein 
wissen — wie das die heurige Gedenkfeier für Brosset gezeigt hat. 

in ^ 

H. SCHÜCHARDT. 



o o 



(T3 



F p. 



u 

«4- ~° 

O <L> 



CU 

c 






M. H. Adjarian ; ßtude sur la langue laze (Extrait des Memoires de 
la Societe de linguistique de Paris, t. x). Paris, E. Bouillon, 1899. 



SS. HO. 



H(ratchia) Adjarian (so nach französischer Umschrift, sonst 
Hraöeay Aöarean), der vorzugsweise auf dem Gebiete der heimischen, 
d. h. der armenischen Sprachwissenschaft tätig ist, hat vor einigen 
Jahren seine Aufmerksamkeit und Mühe dem benachbarten, aber 



nicht verwandten Lafisch zugewendet, von dem wir bisher eine nur 

CO 



allzudürftige Kenntnis hatten. Er hat hauptsächlich die Mundart von 
Batum studiert und zwar in Konstantinopel bei dorther stammenden 

.E -ö 
-ö v 



fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



380 M. H. Adjarian. 

Lafen, sodann auch in Erzerum einem Lafen von Atina Wörter und 
Formen seiner Mundart abgehört. Zu diesem von ihm selbst gesam- 
melten Stoff hat er den von Klaproth, von Rosen, von Peacock, von 
Erckert veröffentlichten hinzugefügt und alles zu einem Wörterbuch 
und zu einer Grammatik verarbeitet; den dritten Teil der Schrift 
bilden Gespräche in der Md. von Batum und Lieder von Atina. Ich 
glaube nicht dass er irgend eine Quelle übersehen hat; allerdings 
druckt A. W. Staröewskij in seinem KaeKascKiü ulojimühz C.-IL 1891 
S. 94—106 und 581—583 lafische Wörter und S. 638 — 641 einen 
Abriss der lafischen Grammatik ab (nach dem Hapisie AnmHH; lies 
Athhh); aber, so viel ich sehe, fusst er in allem und jedem auf 
Rosen. Doch als ganz lückenlos darf ich des Verf.s Wörterbuch 
nicht bezeichnen. Ich denke dabei am wenigsten an die türkischen 
Wörter die er weglässt, während er andere bringt, vielleicht weil 
sie ihm fester eingebürgert zu sein scheinen; nur hätte ich die in 
den Texten vorkommenden sämtlich aufgenommen, besonders des- 
halb weil sie zeigen wie leicht auch Adverbe und Konjunktionen 
(,mehr', ,genau', , vielleicht', ,immer', ,weil') aus dem Türkischen ihren 
Weg in die lafische Umgangssprache von Batum finden oder ge- 
funden haben. Es wäre wertvoll zu wissen unter welchen verschie- 
denen Umständen für ,Gott gebe ihm Gesundheit' gesagt wird: yor- 
motik Sefd met 5 ds (S. 102, io v. u.) und tanrik (türk.) Ufa met § ds 
(S. 104, u v. u.). Für ,Gold< heisst es zu Batum wie zu Atina auf 
türkisch altuni; aber an letzterem Ort sagt man auch okro — georg. 
ok'ro. Wäre das dort ein altes Wort, so wäre die Nachbarschaft des 
kappad. /cycpcc ,Gold' sehr zu beachten; allein es ist zu bedenken 
dass das Mingrelische ork'o hat, von dem durchaus dunkeln arm. 
oski zu schweigen. Verschiedenes was bei den Früheren steht, ver- 
missen wir hier; von Erckert Gewährtes mit dem wenigsten Be- 
dauern, wegen der Fehler von denen sein Buch wimmelt (der Verf. 
gibt S. 2 f. eine kleine Blumenlese davon). Hingegen durften von den 
Wortformen die in der Grammatik oder in den Texten vorkommen, 
keine übergangen werden, und doch suchen wir nicht wenige ver- 
gebens, so odis^iru ,zur Ader lassen' § 112 (von dis%ir ,Blut'), go- 

.£ -o 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original from 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



CÜ 






Cl 



I (ü 
O o 



F P. 



> 

"c 

— o 



Etüde sur la langue laze. 381 

got$andru ,du bist verheiratet' S. 106 (von got§i ,Mann'), dikomod^ana 
,wenn du dich verheiratest S. 106 (von komod^i , Gatte'), mind-u- 
dzaru § 95 (ohne Bed.; zu d^ar- , schreiben'), gasgurina ,du fürchtest 
dich' S. 106 (zu Skur-), onSalu § 123 (ohne Bed.; zu mSal- aus- 
breiten'?), ko-äe-i-naxi § 95 (ohne Bed.; zu na%-, wo das ,Rac. 1° gar- 
der' auf den Ausfall eines ,Rac. 2°' hinweist) u. a. Manches ist nur 
da zu finden wo man es nicht erwartet; Zusammengehöriges wird 
getrennt und Nichtzusammengehöriges verbunden. Z. B. musste mo- 
kideri, ein Partizip unter kid- gestellt werden, tpa%at, welches bei 
Erckert ja für pta%at verdruckt ist (was sich zum Überfluss aus 

dem darüberstehenden mingr. pta%ot ergibt) nicht unter &aj(-, son- 

■ 
dem unter ta%~, auf welches auch bei opatxaps zu verweisen war, 

6 

das offenbar ein Satz ist wie ,die Ader schlägt'. Die Verweise sind 
fM 

auch manchmal zwischen den verschiedenen Lautformen eines und 

desselben Wortes unterblieben, so z. B. zwischen t§qoni und dgoni 
, Eiche', mskueri und skueri, skeri , Hirsch'. Freilich war es oft schwer 
zu entscheiden welche von solchen an die Spitze zu stellen war, 
und daher begegnen uns auch Wiederholungen wie maosa, osmu§ 7 
oseneri — o$eneri, osmus, maoSa — osmus } oseneri, maosa. Die 
Hinzufügung eines umgekehrten Wörterbuches, das sich auf einen 
sehr kleinen Raum zusammendrängen Hess, wäre daher hier beson- 
ders erwünscht gekommen; der Sprachforscher braucht ja unter allen 
Umständen ein doppeltes Wörterbuch und wird z. B. den Unterschied 
zwischen der ScmEFNERSchen Bearbeitung von Uslars Wortsamm- 
lungen und deren Veröffentlichung in der 3mnospa(fii/i Kaem3a leb- 
haft zu Gunsten der letzteren empfinden. Es fragt sich sogar ob 
nicht beim Lafischen dasselbe Verfahren sich empfohlen hätte das 
Lopatinskij (CöopnuKz xn) beim Kabardischen anwandte, nämlich 
die knappere Gestalt dem alphabetischen Verzeichnis der kaukasi- 
schen Wörter zu geben. 

Im Wörterbuch und in der Grammatik ist die Darstellung eine 
beschreibende, keine vergleichende und erklärende. Nirgends ist auf 
das Mingrelische und Georgische verwiesen, und in der Einleitung 
nicht mit einem Worte die Stellung des Lafischen innerhalb der 

£ -o 
-ö v 

E-e 

E =3 

ft3 <D 

in 4-/ 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



F P. 



u 

«4- "O 



382 M. H. Adjarian. 

kharthwelischen Sprachen gekennzeichnet worden, obwohl den mei- 
sten Lesern der Memoires d. I. S. d. I. es doch nicht gegenwärtig 
sein dürfte dass jenes nur eine Abzweigung des Mingrelischen ist. In- 
dessen überschreitet der Verf. an einigen Punkten die enge Grenze 
die er sich gezogen hat, nämlich bei den Entlehnungen. Nicht als 
ob er diese grundsätzlich festzustellen bemüht wäre; er berücksich- 
tigt den griechischen Ursprung gar nicht, weder bei den so schon 
von Rosen gekennzeichneten Wörtern (liman ,Hafen* fehlt ganz; 
wenn es deshalb ist weil der Verf. darin ein zunächst türkisches 
Wort erblickt, so hätte er auch mandre , Stall' weglassen müssen, 
das er ausdrücklich als türkisch angibt), noch bei den von Erckbrt 
(wie korida , Wanze') oder von ihm selbst erhobenen (wie avrosi 
,schön', ,sanfV, oti ,dass', panda jimmer'). 1 Wohl aber, und also will- 
kürlich, türkischen und armenischen Ursprung. Was letzteren an- 
langt, so macht sich nun doch die Verschweigung alles Kharthweli- 
schen fühlbar. Wir haben zunächst Wörter von denen man nicht 
sagen kann dass sie unmittelbar aus dem Armenischen ins Lafische 
übergegangen sind, da sie sich auch im Georgischen (und Mingre- 
lischen) vorfinden, wie baki ,Hürde', but t yi ,Harke* (j^o^xi), kiri 
,Kalk', sampuri ,Spiess* (ßamp'uri). Einzelne davon sind schon alt- 
georgisch, so ambai ,Nachricht* (ambawi). Die Möglichkeit gemein- 
samer Herkunft bleibt bei den nicht echtarmenischen Wörtern zu 
erwägen; lobja, Bohne' (lobio, gur. lobiei, mingr. lebia) dürfte direkt 
aus dem Persischen stammen, und ebenso buli ,Kirsche' (bali y mingr. 
buli ; georg. auch alubali = pers. älübälü). Aber auch daran ist zu 

(L) ^ 

denken dass das armenische Wort das Nachbild des georgischen sein 
kann. Die Gerste heisst laf. keri (k'eri Erck.; und so mingr. georg.), 



CÜ 



ti öl 



Q. 



.TD 






1 Auch dgabu ,Frosch* (zu Batum dgwabu\ Erckkrt hat zabu, mingr. zbabu) 
leitet G. Meyer, Neugriech. St. n, 27, indem er, wohl ohne Gewähr, die Bed. ,Kröte' 



hinzusetzt, aus dem Neugriechischen her, und zwar aus dem von Trapezunt; es 
fragt sich aber ob Cdcpftoc hier die Bed. ^Frosch' hat (sonst ist es , Kröte*) und mit 
breitem Anlaut gesprochen wird. Ich ziehe es vor an russ. owaÖa zu denken, das 

3 o 

in Südrussland ,Frosch' bedeutet. Bei pet§ko ,Kamin* (zu Atina) von russ. nenna 
,Ofen' brauchen wir auch nicht an griechische Vermittelung zu denken; doch ist 
pont. rceaxos ,Ofen* bezeugt. 

-ö v 

E-e 

E =3 

fD O) 

1 1 Digilized by ^.OOglC CORNELL UNIVERSITY 



Original from 



O Q_ 



Etüde sur la langue laze. 383 

arm. gari. Über das letztere weiss Hübschmann, Arm. Etym. S. 432 
keine sichere Auskunft zu geben; zu griech. xpi, xptÖ^ stellt sich georg. 
k'eri, k'rt'ili (Bib.; Erckert hat Ict'ili) jedenfalls näher, und es ist 
dabei an die Übereinstimmung von georg. puri , Weizen* mit griech. 
xupos (s. Zeitschr. xvi, 294) zu erinnern. Auch dass t § i ,Wurm' (georg. 
tjia) vom arm. t§t§i herkommt, gilt mir nicht für völlig ausgemacht, 
obwohl ja für letzteres auch t§it§i bezeugt ist. Die Silbendoppelung, 
welche die kribbelnden, wimmelnden Tiere kennzeichnet (L. v. Pa- 
trübAny, Sprachw. Abh. i, 312 vergleicht mit Recht zum arm. Wort 
das magy. zsizsik ,Kornwurm'; georg. t§it§ina= t§rit§ina , Grille' — 
dann auch ,Libelle' — hat nichts hiermit zu tun, es ahmt den wirk- 
lichen Laut nach), könnte sekundär sein ; das Georgische hat neben 
t§ia auch die Form t§ua. Doch bemerke ich dass t$ia in der Bibel 
nicht vorkommt, sondern matli* vielleicht ist aber auch arm. tjtji 
nicht alt bezeugt. Keinesfalls ist arm. hat$ar ,Roggen' das Stamm- 
wort für das gleichbed. laf. t§uari = mingr. (Eristow) t§we, (Erckert) 
t§uje } georg. t§wawi (Erckert hat ein sonst nicht gebuchtes t§ioari, 
das ich für einen Druckfehler halte, obwohl es zur laf. Form stimmt). 
Allerdings könnte der Verf. sagen dass bei ihm die Beziehung der 
eingeklammerten türkischen und armenischen Wörter eine sehr ver- 
schiedenartige sei, hat er doch ein paar Mal zu lafischen Wörtern 
die türkischen ganz anderslautenden Synonymen gesetzt; auf diesem 
Umwege erfahren wir dass malabe nicht bloss eine ,espfece de pois- 
son', sondern , Karpfen' und wimypna nicht bloss eine ,espfece d'herbe', 
sondern , Farnkraut' ist (= mingr. gwimara, imer. gur. gwimra, gum- 
bra). Warum zu libadi ,sorte de pardessus' in Klammern das 
türk. x er X a statt des gleichbed. türk. lebäd angeführt wird, verstehe 
ich nicht. Auch sonst ist nicht immer die türkische Herkunft an- 
gegeben, so nicht bei gümüsi ,Silber'. Beiläufig sei bemerkt dass 
während das laf. laf- ,sprechen', ebenso wie ähnlich lautende und 
bedeutende Verben des Rumänischen, Serbischen, Albanischen und 
Neugriechischen mit Recht auf türk. läf ,Prahlerei', ,eitle Worte' zu- 



CÜ 



ti öi 



Cl 



03 



(T3 



2 5 
F P. 



«4- ~° 

_N 
'-I-J 



3 ^ 
^ O 

rückgeführt wird, für das georg. laparak- sprechen' wohl das per- 
sische Grundwort vorauszusetzen ist, mit welchem sich ein einhei- 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



384 M. H. Adjarian. 

misches Verb (mingr. swan. ragad-) verbunden hat; denn p (nicht p e ) 
aus / deutet auf eine alte Entlehnung. Man bemerke noch dass die 
türkischen Lehnwörter des Lafischen z. T. auch im pontischen Grie- 
chisch vorkommen, wie artuk ,mehr f , belki (rceXxeT) vielleicht*. 

Die Heranziehung der übrigen kharthwelischen Sprachen würde 
nun aber nicht nur bei andern die wissenschaftliche Erforschung des 
Lafischen gefördert haben, sondern auch beim Verfasser selbst die 
Auffassung und Einstellung der von ihm oder seinen Vorgängern hier 
unmittelbar beobachteten Tatsachen. Natürlich kann die Beobachtung 

00 

einer Sprache oder Mundart eine so umfassende und gründliche sein 
dass eine darauf ruhende Beschreibung nichts zu wünschen übrig 
lässt; wo sie aber, wie im vorliegenden Fall, lückenhaft und teilweise 
unsicher ist, erweist sich Hülfe von auswärts, und doch wiederum 
aus nächster Nähe, geradezu als erforderlich. Eine solche Hülfe 
konnte auch stillschweigend in Anspruch genommen werden, aber 
man hat ganz auf sie verzichtet; nirgends, und zwar weder im 
Positiven noch im Negativen, verrät sich eine Vertrautheit auch nur 
mit dem Georgischen. Dafür will ich im folgenden Belege geben, 
doch zunächst von einem Fehler sprechen welchen der Verf. bei jener 
ganz allgemeinen Kenntnis der kharthwelischen Lautverhältnisse hätte 
vermeiden müssen die er im Eingang andeutet. Er sagt S. 1 f : ,les 
dialectes parles a Test de Batoum ont gard^ toute la richesse de la 
prononciation des langues du Caucase, comme les trois degres des 
consonnes 6, p y pA; d, t y th; i, c, ch, etc., qui k Batoum m6me a 
d&jk disparu; toutefois le q (g tr&s guttural) parait de temps en temps, 
comme dans le mot qoqore (pr. ggoggore). A Xope, Vice, Atina, Arxavi 
on ne distingue que ft, p ; d, t, etc. ; le q est remplacö par </.' Hier- 
bei wäre eine Vorfrage zu erledigen, nämlich die: welches die den 
Kaukasiern eigentümlichen Konsonanten sind. In Bezug auf q kann 
kein Zweifel obwalten, obwohl wir über seine Aussprache noch nicht 
völlig im reinen sind. Im Sommer 1896 untersuchte auf meine Bitte 
E. Sievers die georgischen Konsonanten an einem damals gerade in 
Leipzig befindlichen Georgier, Herrn N. 2ordania und berichtete 






T3 



O o 



(T3 



> <U 
C CT 
=> O 

— o 

c O 

CO 

mir ausführlichst darüber, wofür ich ihm auch hier danke. Auf Grund 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Etüde sur la langue laze. 385 

seiner tiefgehenden und zuverlässigen an einer Person und meiner 
oberflächlicheren an mehreren Personen gemachten Beobachtungen, 
sowie gewisser mittelbarer Erkenntnisse möchte ich folgendes nicht 
eigentlich feststellen, sondern vielmehr als Entwurf für weitere Unter- 
suchungen darbieten. Das q ist ursprünglich eine hintere Guttural- 
tenuis mit Kehlkopfverschluss (verbindet sich daher auch nur mit 
derartigen Tenues und AfFrikaten: p'q, t'q, tsq, t/q), ist dieses aber 
heutzutage nur noch zum Teil; zum Teil ist eine Spirans daraus 
geworden, und zwar auch eine stimmhafte, ebenso wie eine stimm- 

o 

hafte Explosiva. Dabei wird es wohl vor allem auf die Stellung des 
q ankommen ob es anlautend, ob nachkonsonantisch, ob intervoka- 
lisch ist (als Prüfwörter könnte man qoweli, tjqali, baqaqi wählen). 

6 

Ferner ist Verschiedenheit der Aussprache je nach den Gegenden 
zu vermuten; insbesondere ist es wahrscheinlich dass das Imerische 
sich dem Mingrelischen zuneigt, wo unter noch nicht klar erkenn- 
baren Umständen von dem , harten' q ein ,weiches' q sich ab- 
gezweigt hat, zum Teil wiederum mundartlich mit ihm wechselt. 
Wenn im Lafischen q hier als gy y dort als y (ein sehr tiefes) er- 
scheint, so ist das also schon weiter im Norden vorgebildet; und 
i_ i}> 

ebenso wenn es ganz schwindet (was der Verf. nicht uirekt erwähnt; 

doch gibt das Wtb. einige Beispiele davon wie oropa } d^oni } onu). 
Das georg. qoweli kommt für mein Ohr einem oweli weit näher als 
einem koweli; Peacock schreibt das mingr. qude regelmässig ude. 
Anders als bei q liegt die Sache bei den mit Kehlkopfverschluss ge- 
sprochenen Tenues und AfFrikaten denen die mit offenem Kehlkopf 
gesprochenen und deutlich aspirierten gegenüberstehen: k\ p\ t\ 
ts\ tf — k\ p\ t\ ts\ t$\ Wenn hier eine Vereinfachung eintritt, 
nach welcher Seite hin? Es kann doch kaum ein Zweifel darüber 
vorhanden sein dass die Konsonanten der ersten Reihe erlöschen. 
Gleichzeitig mag die Aspiration bei denen der zweiten so reduziert 
werden (gänzlich aufhören kann sie, aus physiologischer Ursache, 
nicht) dass sie als unaspiriert erscheinen. Auch das Stöpselgeräusch 
tritt in verschiedener Abstufung der Dauer auf. Sievers stellte den 
Unterschied der georg. k\ p\ f von arm. k\ p\ £ fest, wie er sie 



o E 



> ^ 
£ ö. 

P 

U 

«4- ~° 

o " 
> 

4-J 

1— 

<u , 

> <u 

C CT 

=> o 

— o 

c O 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



CÜ 



ti öi 



386 M. H. Adjarian. 

von Tiflisern gehört hatte; bei den letzteren erfolge Öffnung des Kehl- 
kopfverschlusses gleichzeitig mit dem Mundverschluss, bei den er- 
steren deutlich nach ihm. Für das Gehör würde eine mittlere Reihe 
sich einstellen, bei der man jedes Hauchzeichen weglassen könnte, 
wenn auch physiologisch sie der zweiten weit näher stünde als der 
ersten. Wie dem nun auch sein mag, auch auf lafischem Gebiete kommt 
die kharthwelische Doppelreihe noch vor. Der Verf. sagt: ,in den 
Mundarten östlich von Batum'; wird denn aber im Osten von Batum 
überhaupt lafisch gesprochen? Ich denke, es liegt eine Verwechse- 
lung mit den im Süden von Batum gesprochenen Mundarten vor. 
Dann aber passt die vorher gemachte Äusserung nicht dass je weiter 
östlich um so reiner die Sprache sei; denn Batum ist zwar nicht ge- 
rade der östlichste, vielmehr der nordöstlichste, auf jeden Fall aber 
hier der äusserste Punkt des von Platana aus, einer Mondsichel gleich, 
am Schwarzen Meere sich dahinziehenden Lafenlandes. Es würde aber 
durchaus nicht Wunder nehmen wenn in jenem Küstenstrich zwischen 
dem Tschoroch und der Reichsgrenze das Lafische seinen kharth- 
welischen Charakter ziemlich rein erhalten hätte, da es sich im Süden 
und Osten mit dem Georgischen berührt. Von dem zusammenhän- 
genden lafischen Gebiet ist nun Batum abgetrennt; man kann aber 
nicht einmal sagen dass es ein lafischer Vorposten ist, sondern nur 
dass es einen solchen in sich fasst und zwar einen recht schwachen. 
Die Lafen bilden nämlich (oder richtiger gesagt, bildeten; denn die 
Zählung von 1886 ist hier zu Grunde gelegt) etwa den 32 sten Teil 
der Gesamtbevölkerung von Batum (Näheres sehe man in meiner 
Abhandlung Zur Geographie und Statistik der kharthivelischen 
Sprachen S. 11 f.). Ihr Zusammenwohnen mit den Mingrelen die den 
13 ten Teil der Batumer ausmachen, mag zur Festigung der gemein- 
samen Züge dienen, die Wahrung der Besonderheiten aber beein- 
trächtigen; und Entsprechendes, nur abgeschwächt, wird hinsichtlich 
der georgisch Redenden der Stadt (Viß) gelten; aber die weit über- 
wiegende Menge, nämlich fünf Sechstel, der Bewohner sind Nicht- 
kharthwelen, darunter sehr viele Griechen (%) und Türken (V12)? 
deren Sprachen also wie jenseits der Grenzen auch hier, obschon in 

LT) tf) 

£ -o 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

fN «/) 

f\l ^ 

, O) 

^ U 

° J^ 

O o 

c v> 

o E 



F p. 



Etüde sur la langue laze. 387 

minderem Grade, das Lafische zu beeinflussen vermögen. In diesen 
gegen 500 Lafen von Batum werden wir nun schwerlich die altein- 
gesessene Kernbevölkerung des vor 1878 ganz bedeutungslosen Ortes 
zu erblicken haben; sie werden wohl aus dem Gebiete südlich vom 
Tschoroch eingewandert sein und von dort immer frischen Zuwachs 
erhalten; aber auch dort beträgt ihre Zahl kaum 1800 ; und G. 
Merzbacher (Aus den Hochregionen des Kaukasus i y 168) hat sich 
um das Neunfache verrechnet als er die russischen Lafen auf 20000 
schätzte. 1 Demnach wenn der Verf. bei seinen Batumer Lafen jene 
doppelten Konsonanten nicht mehr hörte, scheint es mir nicht aus- 
geschlossen dass andere Batumer Lafen sie noch besitzen. Erckert 
gibt leider seine Gewährsmänner für die einzelnen Mundarten nicht 
an; es ist mir aber doch wahrscheinlicher dass der für das Lafische 
zunächst aus Batum, nicht aus jenem ländlichen Bezirk, dem west- 
lichen Drittel des Bezirks Gonia stammte. In seinen Aufzeichnungen 
treten uns jene doppelten Konsonanten entgegen, und mögen nun 
dieselben zu lokalisieren sein wie sie wollen, der Verf., der ja im 
allgemeinen die Schreibung seiner Quellen wiedergibt, musste das 
auch hier und besonders hier tun. Allein er wandelt alle kh, ph 7 
th Erckerts in &, p y t um und zwar auch wenn die betreffende Form 

in ^ 

nur aus Erckert belegt ist; so hat er z. B. ,kvinci', ,pirpili', y tuta* für 
Erckerts ,khvin£i', 7 phirphili', Jhutha'. Das ist um so wunderbarer 
als er bei den Affrikaten den Unterschied aufrecht erhält (wo aller- 
dings die Zeichendifferenzierung auf die mit Kehlkopfverschluss fällt); 
er schreibt hier Erckert nach, z. B. ,dökemi' } ,tcuna' 2 , ohne daraus 
je eine sich darbietende Nutzanwendung zu ziehen; so können z. B. 
getsu ,er schlug' und ot/u ,er nähte' nicht zu dem gleichen Stamm 






(T3 



2 5 

F P. 



1 Wiederum wird es zu wenig sein wenn ihm zufolge die Zahl der türkischen 
Lafen das Vierfache beträgt. Im Feuilleton des Q^nÄob cw&Qnc^o vom 27. Aug. 
1902 (,das Lafenland') finde ich die Zahl sämtlicher Lafen auf 150000 berechnet. 
Der Verf. %. 4., welcher ein besonderes Buch über das Lafenland zu veröffentlichen 
gedenkt, lässt dieses nicht schon am Tschoroch. sondern erst in Makriali beginnen. 

2 Ein Versehen Erckerts ist es wenn er jcuna-tfyuri' schreibt und neben 
ipudzi-tcuna' unter ,Kuh' setzt; es bedeutet ^weibliches Schaf, was auch der Verf. 
hätte erkennen sollen. 

Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 26 

E => 

(ü <D 
w _c 
in 4-/ 

$£ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



388 M. H. Adjarian. 

gehören. Über das Umschreibungssysteni will ich nicht viel Worte 
verlieren; die allgemeinen Grundsätze die Fr. Müller 1897 aufstellte, 
sind auch die meinen, und insbesondere beklage ich mit ihm den 
Missbrauch des Zeichens j. Der Verf. hat wohl j im Sinne von d& 
aus Hübschmanns armenischer Umschreibung entlehnt; warum dann 
nicht auch dessen^' = dz? Für die kharthwelischen Sprachen besteht 
jene ^autoritative' Schreibmethode noch nicht (soweit es sich um 
eine auf dem lateinischen Alphabet beruhende handelt) der man 
sich nach Brügmanns Meinung unterzuordnen hätte, und dem angli- 
sierenden j dürfen wir wohl den Eintritt in den Kaukasus über- 
haupt verwehren. Was das cc in ,%orcca l S. 62, ,%orcei' (viermal) 
S. 105 bedeuten soll, weiss ich nicht. 

Die Bedeutung der Wörter, besonders aber der Verbalstämme 
hätte mit Hülfe des Georgischen in manchen Fällen genauer oder 
richtiger angegeben werden können. Ich verkenne nicht dass das 
franz. Wort nicht sowohl die Bedeutung des vorausgehenden Verbal- 
stammes als solchen angeben soll, sondern wie sie durch die Prä- 
und Suffixe modifiziert ist die in den darauf angeführten Formen 
erscheinen. Also wenn z. B. zu na% gesetzt wird ,garder' ? so bezieht 
sich das auf das folgende komisaenaxi, welches aber keinem Infinitiv 
entspricht, sondern die 1. P. S. Aor. ist. Allein es ist doch wichtig zu 
wissen dass na%- ,regarder' bedeutet, wie georg. na%wa 7 von dem dann 
erst abgeleitet ist §e-na%wa , garder'. U. a. finde ich diesen Artikel: 
9 Pirt Rac. pleuvoir. Cüma upirebun, il va pleuvoir/ Das Fragezeichen 
hätte nach ,pleuvoir' und nicht nach ,pir' gehört, denn dieser Stamm 
liegt zweifellos in upirebun vor. Aber da t s üma ? Regen' bedeutet, so ist 
es doch nicht sehr wahrscheinlich dass upirebun bedeute: ,regnet', ob- 
wohl ja solche Tautologie vorkommt (z. B. magy. esö esik). Und die 
Aufklärung gibt das gleichbed. georg. tgwima apirebs, eig. ,der Regen 
verspricht', wie wir sagen ,der Regen droht'. Auch das dativische u- 
hat sein Entsprechendes im georg. w-u-pireb ,ich beabsichtige'. Noch 
bessere Dienste aber hätte das Georgische beim Verständnis und bei 



CÜ 



ti öi 



Cl 



03 



<=> o 



F P. 



«4- ~° 

_N 
'-I-J 



3 ^ 
O 



der Analyse der grammatischen Formen geleistet. Der Verf. würde 
wohl nicht gesagt haben dass man den Narrativ an Stelle des Norm- 



al ¥? 

ifl Ün 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Etüde sur la langue laze. 389 

nativs gebrauche, wenn man auf das fragliche Wort den Nachdruck 
legen wolle (§ 23), und dass das -li in d^arali ^geschrieben' das türk. 
-li sei (§ 134, 12). Vor allem sind es zwei Kapitel die durch die Nicht- 
berücksichtigung des Georgischen sehr gelitten haben, das über die 
Verbalpräfixe S. 82 ff. und das über die unpersönlichen Verben S. 88 ff. 
In den kharthwelischen Sprachen und so auch im Lafischen 
haben wir drei Arten von Verbalpräfixen: l) die Charaktervokale, 
2) die pronominalen und 3) die präpositionalen Präfixe. Die ersten sind 
dazu bestimmt die Beziehung zum Objekt zu präcisieren ; aber nicht 
immer ist diese heutzutage deutlich ihnen zu entnehmen. Wir sehen 
z. B. das dativische Verhältnis bald durch -i- (dies ist das Regel- 
massige), bald durch -a-, bald gar nicht ausgedrückt: m-i-tjcin ,mir 
ist bewusst' = ,ich weiss', m-a-t 8 onen ,mir ist glaubhaft' = ,ich glaube', 
m-tjcirons ,mir ist Hunger' = ,mich hungert'. ,Ich habe' wird im 
Georgischen ausgedrückt durch m-qaios ,mir ist' (ein Wesen), m-a- 
k r w8 ,mir ist' (eine Sache), im Mingrelischen durch m-quns und 
m-i-yu, im Swanischen durch m-a-qa und m-i-ywa (m-u-yioa oder 
m-u-yo) } im Lafischen aber gleichmässig durch m-i-qonun oder m-t- 
onun (im Wtb. unter onu nur das letztere) und m-i-yun. In den drei 
südlichen Sprachen ist das Zeichen für die 3. P. als Objekt ge- 

LT) d+. 

schwunden, es ist immer im Charaktervokal a- (swan. %-a) mitent- 
halten ; i- aber hat reflexive Bedeutung (,sibi'), und ,ihm' wird durch 
u- (swan. %-6) ausgedrückt, zu m-i-t s kin gehört also u-t§kin ,er weiss'. 
Lqonun, -uni bei Erckert S. 349 und 353, vom Verf. § 104, 3 an- 
geführt, halte ich für ein Versehen statt u-q. Unter diesen umständen 
ist es zulässig oder sogar angezeigt den Charaktervokal mit dem 
Objektspronomen zusammen als ein Präfix zu fassen und dai*- 
zustellen; nur darf man darin nicht etwa eine Kasusform erblicken, 
also das mi von mi-t s kin dem von ital. mi pare vergleichen. So ver- 
zeichnet denn der Verf. m-, mi-, wo- für die 1. P., gi- für die 2. P. 
(es fehlen ma-, 6-, jo- und &-) und u- für die 3. P. als ,pronoms in- 
fixes'. Wenn er sagt dass diese Pronomen ,un rapport entre le sujet 
et le complement direct' anzeigen, so ist das an sich nicht recht klar 

ausgedrückt, und mit Beziehung auf die vorgelegten Beispiele un- 

26* 






U 

O <L> 

CT 



3 ^ 
— O 



ro 0) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



390 M. H. Adjarian. 

richtig; in ihnen allen hat das Pronomen dativische Funktion, während 
sich auch solche mit akkusativischer hätten beibringen lassen. In 
diese erste Klasse der Präfixe, die der pronominalen, hätten nun 
aber auch, wie ich weiter unten zeigen werde, noch andere gehört, 
welche der Verf. der zweiten Klasse zuweist, der der eigentlichen' 
Präfixe, die verschiedene Nuancen der Handlung ' ausdrücken. 
Aber er gesteht ein dass er sich über deren Mechanismus nicht ganz 
klar geworden ist, dass er die Nuancen der Bedeutung welche die 
einzelnen Präfixe verleihen, nicht gefunden hat. Nun, es handelt 
sich hier, von dem Missverstandenen abgesehen, um das was wir in 

fN 

unserer Sprache als ,untrennbare Präpositionen' kennen, und was im 

fN 

Grunde Adverben sind; entsprechende besitzt das Georgische, und 
zwar decken sich die einzelnen zum Teil mit den lafischen. Es ist 
mir unverständlich wie der Verf. sagen kann, Erckert habe ,gewagt' 

fN 

den Sinn von einigen derselben zu präcisieren. Allerdings bereitet 
bei den häufigsten dieser Präfixe die Darstellung und Erklärung des 
Zusammenhangs zwischen den variierenden Bedeutungen ähnliche 
Schwierigkeiten wie bei unserem 6e-, er- u. s. w. ; aber damit befasst 
sich ja 1 Erckert gar nicht. Er gibt nur (S. 352) für eine Reihe von 
Zusammensetzungen mit t/ar- (= d^ar- Verf.) schreiben' die Be- 
deutungen an, die sich doch unmittelbar feststellen lassen, und setzt die 
gleichbedeutenden georgischen Verben daneben, sei es mit gleichen 
Präfixen, wie e-t£arala = a-tjera beschreiben' (eig. aufschreiben'), 
sei es mit verschiedenen, wie k'o-me-tjaru = tgar-tgera ,Aufschrift', 
wobei ein paar Irrtümer untergelaufen zu sein scheinen. Wenn der 
Verf. mit seinem beschränkten Stoff nicht ins reine zu kommen wusste, 
so hätte ihn wenigstens hier und da das Georgische auf die rechte 
Spur bringen können. Er hätte dann z. B. mo- (mw-, ma~) ,her' und 
me- (mi-) ,hin' wohl nicht zusammengeworfen, die ja übrigens in 
mo-yulu ,ich komme 4 und me-yulu ,ich gehe', in mo-m~t § i, ma-m-tgi ,gib 
mir' und ko-me-b-tji ,ich gab' sich so deutlich wie möglich scheiden. 
Das Mingrelische und Lafische haben nun präpositionale Präfixe die 
das Georgische nicht hat, sie inachen von ihnen überhaupt einen weit 
stärkeren Gebrauch als dieses (drei zusammen sind ganz gewöhnlich) 






T3 
Q. 



i fö 
O o 

c v> 
o E 

^-^ 4-1 

TD ±3 
„ rg 

i 

- Q. 

P 

ro ^ 
U 

«4- ~° 

O <L> 
N 
'-i-J 
O 

fc =9 
> <u 

c 
ro 

ifl tn 

£ -o 
-ö v 

E-e 

E => 

(O O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Etüde sur la langue laze. 391 

und lassen endlich, dank der Neigung zur Assimilation, die Vokale 
vielfach wechseln; aus alledem und aus der noch dürftigen Be- 
schaffenheit unserer Hülfsmittel erklärt es sich dass uns hier nicht 
wenige Zweifel aufstossen. Von do- und ko- hatte Rosen S. 13 mit 
Recht behauptet dass sie das Präteritum näher zu bezeichnen pflegen, 
doch unbeschadet der Verständlichkeit fehlen dürfen. Aus dem letz- 
teren Umstand, dem häufigen Fehlen schliesst der Verf. § 98 dass 
sich Rosen getäuscht habe; aber er selbst hat sich getäuscht, und 
auch im Mingrelischen versehen do- (wie georg. da-) und ko- jenes 
Amt. Einmal hat der Verf. das Verbalpräfix gi- für ein Nominalsuffix 
-gi gehalten. Neben upi ,Schweiss' verzeichnet er upigi- das ist offen- 
bar aus dem folgenden upigi mo %up8 missverständlich entnommen, 
welches zu schreiben ist upi gimoyups ,ich schwitze', eig. ,Schweiss 
giesst sich mir aus' (yumala ,ausgiessen', wohl = georg. syma, dass.; 
georg. opHi ma-syams ,ich schwitze'). Dasselbe Präfix begegnet uns 
in dem gleichbedeutenden upi gemein (vom Verf. S. 59. 106 in einem 
Wort geschrieben) ; es ist — georg. ga- ,aus-'. Besonders unter n-, na-, 
ni-, no-, nü-, nu- hat der Verf. sehr Verschiedenartiges zusammen- 
gehäuft. Nur in sehr wenigen Fällen scheint es sich um ein ursprüng- 
liches präpositionales no- zu handeln. In gewissen andern ist n- aus 
me- (georg. mi-) vor dunkelem Vokal entstanden, so in nüswi (nicht 
nUSwi) , ziehe' für *nj-u-swi \ *me-u-swi zur 1. P. S. Praes. me-w-u- 
sware, nü§welare (nicht niste.) ,du hilfst' für *me - u - Swelare zur 
1. P. S. Praes. me-ic-u-§welare und ebenso nüsweli ,hilf. Diese von 
Rosen überlieferten Formen verraten auch in der Trübung des Vokals 
den angegebenen Ursprung. Hierher gehören aber nun auch die S. 95 
verzeichneten Formen nulu ,du gehst', nulun ,er geht' zur 1. P. S. 



■o 






w i 

fN CO 

O u 



O o 
c ^ 

o E 



(T3 



"f P- 



Praes. me-y-ulu (gegenüber von mulu ,du kommst', mulun ,er kommt' 
zu mo-y-ulu), welche der Batumer Mundart angehören und in denen 

° N 

-u- unverändert bleibt. Auch in der Mundart von Atina ist dies mit 
-o- und -a- der Fall, so nach Rosen: n-o-yoskini ,lösche aus' (der Verf. 



Praes. me-w-o-yoskinare, n-o-ywati ,beisse' zu me-w-o-ywatare 7 n-a-yuli 



_N 
'-I-J 
'Ol 

fc =9 
> <u 

schreibt im Wtb. für ,auslöschen' irrigerweise ,auslösen') zur 1. P. S. 

,nähere' zu mew-a-yulare. Wenn er auch n-o-dmdi , nagele' zu 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



392 M. H. Adjarian. 

m-o-w-o-dgadare gibt, so ist das letztere vielleicht erst durch Assimila- 
tion aus ^m-e-w-o-diadare entstanden; für no-i-seli ,stehe auf zu 
mo-w-iselare passt aber diese Erklärung nicht. Endlich findet sich 
unter den ,Präfixen' des Verf.s auch stammhaftes n- und zwar zu- 
nächst als primäres in o-na-%u , waschen', welches auch das Wtb. 
unter %u stellt ; es ist o-na%u abzuteilen = mingr. na%ua. Die Form 
na-b-yware liefert keinen Gegenbeweis, sie steht für *b-na%ware^ 
dieser Anlaut bot Schwierigkeit, das b ist in den Stamm hinein- 
gesprungen, also wirkliches Infix geworden, wovon unten weitere 
Beispiele gegeben werden. Sodann haben wir ein sekundär stamm- 
haftes n-, dem unmittelbar ein Konsonant folgt. Dass es wirklich 
stammhaft ist, ersehen wir daraus dass die pronominalen Präfixe 
(mit Einschluss der Charaktervokale) ihm vorausgehen; denn diese 
folgen regelmässig den andern Präfixen; es ist also abzuteilen: de- 
W'i-nt§iri, do-w-o-nt & %unare , me-u-ntxi, mo-w-u-nzinare. Wenn das 
Zeichen der 1. P. des Subjekts 6-, über welches gleich das Nähere 
gesagt werden wird, mit diesem n- zusammenstösst, so verschmilzt 
es mit ihm zu m-, z. B. me-mdrigat ,lasst uns biegen' zu mo-ndrukala 
,biegen', mdgarare ,ich schreibe' neben ndiarare ,du schreibst', ko~ 
mzare ,ich öffne' neben ko-nzi ,öffne' (das Nebeneinander von ka-go- 
ntjei und ka-go-mtjci ,ich öffnete', sowie von go-ntjcima und go- 
mtjcima ,öffnen' ist dem Verf. nicht ohne weiteres zu glauben). Dieses 
n- dürfte nur vor Dentalen vorkommen (der Verf. fragt S. 84 unten ob 
o- vor t§ oder di zu on- werde) und macht den Eindruck eines aus 
ihnen entwickelten Lautes; es ist allerdings ganz bedeutungslos, 
beruht aber offenbar auf der Analogie eines wirklichen Präfixes. Im 
Kharthwelischen werden mit m- Partizipe gebildet, z. B. georg. tjera 
schreiben', m-i/m schreibend', die öfter Substantivbedeutung an- 
nehmen, z. B. m-p'rinweli ,Vogel' (eig. ,fliegend'). Dieses m- schwindet 
mehrfach, z. B. p'rinweli, ist aber umgekehrt einer ausserordentlich 
grossen Menge von Substantiven und Adjektiven hinzugefügt worden. 
Die Übereinstimmung zwischen den einzelnen Sprachen ist keine voll- 

CO 



w I 

fN CO 

, O) 

O u 



O o 

c v> 
o E 



(T3 



2 5 



F P. 



u 

«4- ~° 



ständige; das Lafische hat viele solcher ,un organischen' m- des Geor- 
gischen nicht, anderseits aber z. B. mti, ti == mingr. ti 7 georg. tili 

£ -o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Etüde sur la langue laze. 393 

,Laus', mtugi, tugi = georg. tfagivi ,Maus'. Der Verf. sagt § 35 dass 
zwischen dem Adjektiv und dem Substantiv häufig ein m eingeschoben 
werde, das die gelehrten Wortsammler öfters getäuscht habe (indem 
sie es als zum folgenden Wort gehörig betrachteten). Aber dieses m 
findet sich nicht nur in dieser Stellung, sondern wie das zweite von 
den Beispielen des Verf.s zeigen würde wenn es nicht fehlerhaft 
wäre (mayam bei Erckert ist in mayali zu verbessern), zwischen 
dem prädikativischen Adjektiv und der Kopula, wie ein § 32 an- 
geführter Satz zeigt, zwischen dem Subjekt und dem prädikativischen 
Adjektiv und wie ein Satz der Gespräche S. 105, 9 zeigt, zwischen 
Subjekt und Verb. Zum Teil handelt es sich gewiss um das früher 
besprochene m- (z. B. in didim tugi S. 57, t§ipemti, t^iperntoki S. 13); 
in manchen Fällen, wie t s itam o%ori 104, 4, at,im ot% 104, 11 ist diese 
Möglichkeit allerdings ganz ausgeschlossen. Es ist begreiflich wie 
vom Partizip aus das m- auch in manche Verben eingedrungen ist, 
z. B. georg. myera = swan. liyral , singen', mzera , betrachten' = laf. 
od z iru y mingr. d z irap'a ,sehen'. Das Mingrelische, nicht das Lafische, 
liebt es m- durch n- zu ersetzen, so ngeri, geri = laf. mgeri, georg. 
mgeli ,Wolf, uteri, teri = georg. mteri , Feind', ntweri, tweri = laf. 
georg. mtweri ,Staub', und so nun auch bei Verben, wie ngara, gara 
(imgarat bei Erckert bedeutet ,lasst uns weinen!' und ist = *i-6- 
ngarat] s. vorherg. S.) = laf. omgaru (Rosen: obkarinu), swan. ligwni 
(Erckert hat ligoni), georg. godeba , weinen'; guunt^guu = georg. 
gaut,qo ,er richtete ihm ein'; nt'%orua, t K yprua = georg. t r %ra ,graben'. 
Auch das Georgische kennt so n- für m-: nd z rewa — d z rwa ,bewegen, 
schütteln', nt'yfiwa — t'%ewa ,ausgiessen', ndzrewa = mywrewa ,(eine 
Flüssigkeit) durchschütteln'. Das Lafische, welches sonst das m- 



■o 






w i 

fN CO 

O u 



o o 

c v> 
o 2 



F P. 



begünstigt, weist es beim Verb nur selten auf; so wenigstens in 
dem eben erwähnten omgaru ,weinen', sowie in mt§enapa , empfehlen' 
(vgl. georg. t§ena ,zeigen' und t § weneba , zeigen', ,bezeichnen') ufld in 
omtinu (Perf. ivimti) = mingr. rt'ina ,fliehen'. Wo nur erste Personen 



wSale ,ich breitete aus', kann an m- für b-n- gedacht werden ; bei 



0> 
_N 
'-I-J 

'oi 
£ =5 
> <u 

angeführt sind, wie bei gomt 3 ile%i ,ich wand' und JcomSali = georg. 

letzterem um so mehr als der Infinitiv onSalu § 123 dazu zu gehören 

E-e 

E => 

to _c 
in 4-/ 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



t! öi 



394 M. H. Adjarian. 

scheint. Domzadi ,ich kochte' ist georg. dawamzade ,ich bereitete' 
vom Adv. mzad ,bereit' (Adj. mza, mingr. mze). Sehr häufig aber 
sind Verben mit n-, und das würde also aus dem Mingrelischen 
stammen, wenngleich nicht im einzelnen Falle. So haben wir: 
mondrukula = mingr. modirikua, georg. modreka ,biegen'; ond ä aru 
= d^anca, mingr. t§arua, georg. t/era ^schreiben' (der Imperativ 
mdgari, den der Verf. nach Rosen angibt, findet sich bei diesem 
nicht); ond^ru = djiroma, mingr. ondjiru , schlafen', georg. d s ili 
, Schlaf (vgl. odginu = georg. d z inwa ^schlafen'); ont § alu (ist dieses 
etwa mit dem onsalu § 123 gemeint?) = mingr. t s alua 7 georg. t 9 elwa 
,mähen'; ont^iru = mingr. t s urua, georg. t 8 urwa ^schwimmen'; ondgimu 
= mingr. t$wima, georg. tstuima ,regnen'; ont'yoru ,begiessen' = 
georg. nt'xewa, Vyewa (s. oben) ; kagowontxui = georg. gawa£%owe ,ich 
verheiratete' (georg. gawit r %owe ,ich heiratete', auch mingr. t s ilisi 
t'yuala ,heiraten') und sonst. Nur in ont$%unu ,heiss machen' neben 
ot§xunu ,heiss sein 4 wohnt dem n- eine Funktion inne, die faktitive. 
Die Unfähigkeit des Verf. zu analysieren äussert sich besonders 
auffällig bezüglich des Zeichens für die 1. P. als Subjekt. Dasselbe 
ist im Georgischen immer w-, so auch im Mingrelischen und Lafi- 
schen vor Vokal, vor Konsonant aber b- (p-). Georg. w-t t y er, mingr. 
p-t/arj, laf. b-d^arub bedeutet ,ich schreibe', aber t a f er, t§arj, d^arub 
,du schreibst'; daraus geht mit mathematischer Sicherheit hervor 
dass w-, 5- (p-) die 1. P. als Subjekt ausdrückt — das Einzige was 
in Frage gestellt werden könnte, ist die Ursprünglichkeit dieser 
Funktion. Es kommt ja vor dass irgend ein Laut oder eine Laut- 
gruppe von der eigentlich zugehörigen Funktion auf eine zufällig 
mit dieser zusammengeordneten übergeht. Aber einerseits lässt sich 
w-, b- lautgeschichtlich aufs beste mit dem Vollpronomen me, ma ver- 
einigen, anderseits für eine andere Bedeutung die ihm früher zuge- 
kommen wäre, auch nicht der geringste Anhalt vorbringen. Es ist 
daher ganz unerfindlich wie der Verf. diese Erklärung des w-, b- 
für das Lafische beanstanden kann. Die Berufung darauf dass diese 
Konsonanten oft in den ersten Personen fehlen, ist nicht stichhaltig. 
Wenn sie fehlen, so fehlen sie nicht von Anfang an, sie sind ge- 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorn 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



w I 

° m 



o E 



§ S 



Etüde sur la langüb lazb. 395 

seh wunden. Das geschieht auch im Georgischen gelegentlich, z. B. 
ut^er für wut^er (CmjNDADfE, \s*<rr>o$rfr$$™frr%. ^fcogemo S. 42 f.). Ganz 
so ist nun auch w- vor u im Lafischen geschwunden, z. B. in umt$e- 
naminon, umt 9 ile%aminon y besonders aber wenn ein Vokal vorausgeht: 
doubaxt$iH 7 dout 9 pi (neben wut 9 paminon) kaeut 9 ini (neben ivut 9 ina- 
minon), meubari u. s. w. Man vergleiche mit diesem Schwund des 
w- seine Dissimilation zu y in moyulu, meyulu (s. oben S. 391). Ebenso 
pflegt w- nach o vor i zu schwinden, z. B. doiSkuidi (neben wiskui- 
daminori), doit 9 yi (neben wit 9 xaminon), doiyurab (neben dowi%uri), 
dibadi für *doibadi (neben wibadaminon). Für ,ich bin' wird ore 
neben wore y bore angegeben (§ 99). Dass 6- vor Konsonant und be- 
sonders vor mehreren Konsonanten leicht verschluckt werden kann, 
begreift sich. Wenn der Verf. § 76 bd^arub^ bd^arubt schreibt, aber 
§ 100 df(zrub y d^ambt, oder S. 28 bd~araminon, aber S. 88 d^ara- 
minon, so könnte man auf den ersten Blick an eine mundartliche 
Verschiedenheit denken; indessen ergibt sich dass beiderlei Formen 
nach Batum gehören. Es beruht vielmehr das Setzen und Nicht- 
setzen auf Nachlässigkeit; so lesen wir § 76 bdgdrub, bd^arubt auch 
in der 2. P., tjeabt auch in der 1. P. (neben bt 8 kab), § 80 kosubtit 
auch in der 1. P. (neben bkosubti), § 81 dokosi, dokosit auch in der 
1. P. (aber S. 33 dobkosi). Mit einem folgenden stammhaften b- muss 
das pronominale b- zusammenfallen : dobari, dobayi, doboni, doburi, 
oder eine andere Gestalt annehmen: dombadi (georg. dawbade), oder 
eine andere Stelle einnehmen : dobribsare (nicht dobrisare, wie der 
Verf. S. 8 hat) zum Inf. obrisu* vgl. mingr. deebabdi (= georg. da- 
wibade). — Das Zeichen für die 1. P. ist vom Verf. nicht nur für 
irgend ein geheimnissvolles Präfix gehalten worden, sondern zum 
grossen Teil für den Stammanlaut. Dass das m- aus b-n- gelegent- 
lich als stammhaft betrachtet wird, habe ich schon erwähnt. Im 
Wtb. stehen fünf mit w beginnende Verbalstämme; da sie aber nur 



ö öi 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



(T3 



2 5 



F P. 



u 

«4- ~° 



der Verf. scheint eben nur die ersten Personen abgefragt zu haben, 



mit ersten Personen belegt sind, keine mit einem Infinitiv, so regt 
sich der Verdacht, dieses w- sei das Zeichen für die 1. P. Er wäre 
bei Mitteilung der zweiten Personen gar nicht möglich gewesen ; aber 

.c ^ 

ifl tn 

£ -o 

-ö v 

E-e 

E => 

(ü <D 
w .c 
in 4-/ 

$£ 

1 1 b Y ^ ,( ,0 Jy e CORNELL UNIVERSITY 



Original fronn 






396 M. H. Adjarian. 

und er hätte uns wenigstens dessen versichern sollen, überhaupt ge- 
nauer darüber unterrichten wie weit sein Studium des Lafischen 
gediehen war. Für kogiivat§gi ,ich fing an' fragt er: wat s g oder t$g? 
Die Antwort hätte das Georgische gegeben: dawit,qe (Inf. datgqeba, 
mingr. doumua Starö.). Die Frage war in allen vier andern Fällen 
zu wiederholen. Komowogi ,ich gewann' entspricht dem Sinne nach 
dem georg. mowige ,ich gewann', mowuge ,ich gewann von ihm'; 
haben wir aber hier das g des vieldeutigen georg. geba (Inf.), so 
steckt dasselbe wohl auch in kogiwagi ,ich gewöhnte mich' (vgl. z. B. 

o 

georg. gangeba , verwalten'). In giwati ,ich fiel' könnte t das gleiche 
sein wie in ewotare ,ich komme an', also die allgemeine Bedeutung 
,sich bewegen' o. ä. haben. In Bezug auf komiwantji ,ich näherte 

6 

mich', kagonuwant$i ,ich zog mich zurück' weiss ich gar nichts zu 

r--> 

sagen. In einigen Fällen ist die Verkennung des Zeichens für die 
1. P., und zwar in der Gestalt p-, mit ganz besonderen Umständen 
verknüpft. Der Verf. stellt pt, kt, %t, ft als Varianten eines und des- 
selben Verbalstammes in komopti ,ich kam', kamapti ,ich ging hinein' 
u. s. w. auf. Die § 118 gegebenen Paradigmen: komobti, komo%ti y 
komoytUy komobtit u. s. w. (Bat.) und meftare ,ich komme', meytare, 

l_ in 

meytasere, meftatere u. s. w. (At.) zeigen ganz deutlich dass b oder p 
(ich weiss nicht warum der Verf. sich verschiedener Schreibung be- 
dient) und / soviel sind wie ,ich'. Schwieriger aber ist das % zu 
erklären. Man könnte es als stammhaft betrachten, komopti aus 
*komopyti entstehen lassen (so dachte Rosen S. 24) und der im Wtb. 
hinzugesetzte Inf. goytimu ,gehen' (der übrigens vielmehr zu gopti ,ich 
ging hin und her' gehören würde) scheint ja einen Stamm yt ausser 
Zweifel zu stellen. Allein die Bedeutung dieser von Erckert über- 
nommenen Form ist nicht die angegebene; allerdings steht hier unter 
,gehen' auch goyt'imu, aber dies wird nur herausgeschält sein aus dem 
zusammengesetzten Ausdruck tsxenit'e gotfimu, welcher unter ,fahren' 
und unter ,reiten' verzeichnet ist. Da hier im Mingrelischen beide Male 
Uxenit' giluula steht (das gibuulo an zweiter Stelle wird ein Druck, 
fehler sein), dieses aber eigentlich so viel ist wie ,zu Pferde gehen', 
so wurde die gleiche Bedeutung für das Lafische vorausgesetzt. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



O E 



§ S 



Ij/TUDE SÜR LA LANGUE LAZE. 397 

Laf. tgxenitfe go%t r imu scheint mir vielmehr dem georg. t 8 %enzed 
gasxdoma ? zu Pferde sitzen' zu entsprechen, vom Instrumental abge- 
sehen; ,pferdlings sitzen' würde dann seine Bedeutung erweitert 
haben, wie franz. monter ä chevaji. Und dies wird bestätigt durch 
die Formen gjeb%edare ? ich reite' und dob%edare ; ich sitze', welche 
Rosen gibt. Allerdings lautet der Infinitiv zu diesen beiden Formen 
bei ihm gje%onu und do%unu, und auch für das Mingrelische hat 
Erckert doyuna } sitzen' neben dobypdat ,lasst uns sitzen'. Ich 
glaube dass zwei gleichbedeutende und wohl auch miteinander ver- 
wandte Stämme für ,sitzen' vorhanden sind; und wenn dem Verf. 
zufolge -ypnu zu %on~ in ko%en ,er sitzt' (hinzuzufügen war aus 
Peacock : molaren ,er wohnt') gehört, so wird yt'imu zu %ed- ge- 
hören. Was nun das % von lcomoyti ,du kamst', und den entspre- 
chenden Formen der andern zusammengesetzten Verben anlangt, so 
ist es das ursprünglich allgemeine Zeichen für die 2. P., das in 
diesem einzigen Fall sich erhalten hat. Das Georgische hat es ebenso 
in mo%wed ,du kamst' und mo%wal ,du wirst kommen' (wo % zur 
Scheidung von der 1. P. dient, die vor dem stammhaften w- das per- 

.c o 

sonale w~ nicht bewahren konnte), sowie in yar ,du bist' (laf. ore, 

i_ i>) 

re). Im Lafischen ist das % in die 3. P. eingedrungen, die ja sonst 
ausnahmlos mit der 2. P. im Anlaut übereinstimmt. Wenn der Verf. 

in £ 

° I 

unter jeyt (bei ihm y-) ,aufgehen' (von der Sonne) die ersten Per- 
sonen jexti, je%taminon anführt, so liegt vielleicht ein Irrtum vor; 

H öl 

je- = e- entspricht dem georg. ay-; je%tu ,sie ging auf würde sich 
gut zu homoyiu u. s. w. fügen. Das für den Stamm übrig bleibende 
t lässt zunächst an das d von laf. toidi ,ich ging' oder von georg. 
mowdiwar ,ich komme' denken; aber auch das rV in mingr. mexorVi 
,ich kam', molart r § ,er ging fort', gilawrtHVj ,wir gingen öfters 
hin' u. s. w. ist in Erwägung zu ziehen. Unter (p)t und nicht unter 
lipt musste der Verf. birdenbire liptat ,lasst uns überfallen!' (nach 
Erckert, der aber birdendire hat) setzen, welches eigentlich (das erste 






U 
O <L> 

*S 

'i/i öi 

s_ 

> <U 

c 

=) 



Wort ist wohl türkisch 1 ) bedeutet: ,lasst uns (heimlich oder plötzlich) 



1 D. Oekonomides, Lautlehre des Politischen S. 135 erklärt ritpiev (d. i. birden) 
für türkisch mit der Bed. ,ganz'; aber ist das letztere richtig? ,Ganz' heisst auf 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



398 M. H. Adjarian. 

herangehen V — Rosen hatte aus pilare ,ich tödte', dopili ,ich tödtete', 
ili ,tödte', ojilu ,tödten' durchaus richtig einen Stamm il erschlossen, 
während der Verf. neben diesem (und zwar auch in der Gestalt V) 
einen Stamm pil ansetzt. II- steht für *qil-, pilare für *pqilare; das 
q ist verstummt wie in andern Fällen (s. oben S. 385). In ganz ent- 
sprechender Weise hat das Mingrelische zu q'vilua (y ist von w ver- 
schieden) ,tödten' (= georg. klwd) : dopilat ,tödten wir!', dopili ? ich 
tödtete'. Dudi ipili bei Tsagareli, 9uc. M. ii, 27 = yöu^z ce6n be- 
zieht sich natürlich auf die 1. P. Ebendaselbst muss aber pilua, 
dopilua, yöueamh stutzig machen; die Aufklärung finden wir bei 
P. Ts'araia im 8ctlö9&q 1895 Okt. n, 75 (in einem Aufsatz: ,Die ver- 
wandtschaftlichen Beziehungen des Mingrelischen zum Georgischen'), 
wo dopilua als Erzählungsform der Vergangenheit bestimmt wird, zu 
übersetzen mit : yöujiz (eoeopumz) MenH y während yöueamz sein würde 
q'vilua. Ferner setzt Tsagareli a. a. 0. dopqilu dem georg. 9cnJje»a 
gleich; es muss statt dessen heissen 3wl9j^ ,er tödtete mich', wir 
haben auch hier p- als Zeichen für die 1. P. als Objekt. Im kauka- 
sischen CöopnuKi X, ii, 306 (Wtb.) steht pil§ndi, yßuecuiz, aber die 
betreffende Textstelle S. 288, 20 hat muSeni bpilgndi ma sia?, 3a- 
vümz mu xouzevih mcur yöumhP, ebend. XVIII, i, 51 (Wtb.) zwar richtig 
pile, ecjiu y6bK> y aber pil§ns, yöueaemz (so ist S. 58 q'vilgns richtig 
übersetzt) = S. 28 No. 17, 6 mu pilgns, umb Menn yßbemz. — Ganz 
ebenso wie mit dem p- von pilare u. s. w. verhält es sich mit dem 
von pare ,ich mache', (do)pi ,ich machte' (neben are ,du machst 2 , 
(do)i ,du machtest', i ,mache', ikums ^machend', diu ,machen'). Rosen 
glaubt hier einen Stamm i zu erkennen, setzt aber ein Fragezeichen 
dazu; der Verf. schwankt zwischen i- und p-, gibt aber dem letzteren 
den Vorzug. Vom Stamm ist in diesen Formen, ikums ausgenommen, 
gar nichts mehr vorhanden; ganz erhalten ist er in georg. qaw-. Mit 
dem passiven (eig. reflexiven) i- versehen erhielt das Verb die Be- 
deutung ,gemacht werden', ,sein'. So haben wir denn: 

> 0) 

C CT 

=> o 

— o 

türkisch bütün (-un) (daher laf. bitun »immer 4 S. 102, 5), und türk. birdem bedeutet 

.einen Augenblick'. 

ifl in 

£ -o 
-ö v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

ü Q_ 



CÜ 






Cl 



I (ü 
O o 



F P. 



Etüde sur la langue laze. 399 

georg. w-qaw, 3. P. qo ,machte' == laf. pi, 3. P. ? 
georg. w-i-qaw(i), 3. P. i-qo ,war' = mingr. ipqii, ipii, 3. P. iqu 
= laf. (Bat.) w-i-yui, 3. P. (d-)i-xu, (At.) de-w-i-ji, 3. P. d-i-u. 

Hierzu ist zu bemerken dass im Mingrelischen nach Tsagareli S. 10 
(§ 3, A, a) das passive i- den pronominalen Präfixen vorausgeht; doch 
hat er S. 70 wiqii für ipqii. Das mingr. q steht für q'v } qw wie in 
k'iq'ana = fciq'wana ,Welt', besonders aber in 'der oben erwähnten 
Form dopqilu für dopqvilu. Im Lafischen ist beim aktiven Verb 
sowohl q als w geschwunden: pi ist } *pqi } *p-qw-i; die 3. P. müsste 
u lauten; wenn der Verf. hörte kapineri pi ,ich beeilte mich', 
konnte er nicht erfragen wie man für ,er beeilte sich' sagt? Übri- 
gens, da hier die Bedeutung von pi nicht sehr klar hervortritt (kapi- 
neri ist Adverb: ,rasch'; also wohl ,ich that es rasch', wie ja auch 
bei uns das Volk sagt: ,ich machte rasch'), so hätte er nach Peacock 
dido gza pi ,ich machte einen grossen Weg' anführen sollen. In der 
Mundart von Atina, wie sie bei Rosen dargestellt ist, verhält sich 
das passive Verb ganz so wie das aktive ; dewiji ist l *dewii 1 *de- 
uriqi}*do-wi-qw-i] und diu}*do-i-qw-u (oder *-qu J *-qaw ?). Die 
Batumer Mundart aber wahrt hier qw als %u oder %w] Erckerts u%wa$ 
(,er sei', unter ,sein') ist gewiss in i%was (Verf. S. 87) zu verbessern = 
mingr. ikuas (ebend.), georg. iqos. Wenn diu nach Rosen ist ,war' 
und ,gewesen', so lässt sich nicht recht begreifen wie diu auch 
,machen' sein soll; aber noch weniger vermag ich das Part, ikums 
zu erklären. Das Lafische hat auch oywenu im Sinne von ,machen'; 
der Verf. stellt es zu oypnanu und weiter zu oyinapu, die ebenfalls 
, machen' bedeuten; ich denke aber, es gehört zum intransitiven wiyui 
u. s. w. und insbesondere zu ikwen ,er wird', ma ma%wenen borti ,ich 
mag sein'. 

Der Verf. hat nun unter die Präfixe der zweiten Klasse auch 
solche eingereiht die bei ihm schon in der ersten Klasse verzeichnet 
waren. So ma- in mat 8 onu ,es hat mir gefallen'. Besonders aber u- 
in ubars y meubari (galaH ubars = georg. kari uberaws ,der Wind 
bläst [darauf]'; (mejubari = georg. wubere ,ich blies [darauf]'), yeu- 
t$opi (,ich hielt fest [ihm]' ; Dativ statt Akkusativ, wie es in verschie- 






w i 

CN CO 

fN ^ 

, O) 

° m 

i fD 

m - 

o 5 

c v> 

o E 



'i/i öi 
> <U 
=) O 



fD 
^ LO 

.E -ö 
-ö £ 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



400 M. H. Adjarian. 

denen Sprachen bei Verben dieser Bedeutung vorkommt), kojlauyedi 
(,ich setzte mich ihm zur Seite', ,ich flüchtete zu ihm'; -w- ist für 
-10-U-* hierzu gehört der Inf. ilayonud). In ot 9 uri ,zeige' wird o- für u- 
stehen, vgl. georg. ut 5 wene ,zeige ihm'; in andern Fällen ist o- unklar. 
Das Kapitel über die ^unpersönlichen' Verben gibt zu besonders 
vielen Ausstellungen Anlass. Von diesen Verben, deren Subjekt (das 
psychologische nämlich) im Dativ steht, sind nur wenige wirklich 
unpersönlich, subjektlos, d. h. ohne grammatisches Subjekt, wie ,es 
friert mich' = ,ich friere', ,es dürstet mich' = ,ich dürste'. Mit diesen 
sind andere persönliche vermengt, wie ,es ist mir bekannt' = ,ich 
weiss' (etwas), ,es wird mir hörbar' = ,ich höre' (etwas). Rosen hat 
ganz Recht wenn er jene umschreibt: ,mir ist Durst' u. s. w., aber 
Unrecht wenn er auch diese umschreibt: ,mir ist Gehör' u. s. w. und 
ebenso der Verf. wenn er, ihm folgend, sagt, mit s kin bedeute buch- 
stäblich : ,il y a science a moi'. Man kann nicht einmal sagen dass 
bei diesen Verben die 3. P. als grammatisches Subjekt etwas Wesent- 
liches oder gar Unerlässliches ist; es wird das durch die Bedeutung 
jedes Verbs bestimmt. Während im Georgischen ak'ws ,mir ist' = 

c o 

,ich habe', weil auf Sachen bezogen, nur in der 3. P. besteht, ist das 
bei mqaws ,mir ist' = ,ich habe', weil auf lebende Wesen bezogen, 
nicht der Fall, und man sagt mqawyar ,mir bist du' = ,ich habe dich', 
gqawar ,dir bin ich' = ,du hast mich' und wqawar ,ich bin ihm' = 
,er hat mich' (wo ,ich' doppelt ausgedrückt ist). Ebenso wird es sich 
im Lafischen mit iqonun oder uqonun ,er hat' (s. oben S. 389) ver- 
halten. Im einzelnen ist folgendes zu bemerken. 5. %t 8 un kann der 
Bedeutung nach (3. P. Praes. von ,faulen'), dob%t 8 i ,ich faulte' auch 
der Form nach gar nicht hierher gehören. 7. tanun ebenso wenig, 
seiner Übersetzung im Wtb. (,il brille') gemäss ; es scheint dass der 
Verf. -n als Zeichen der unpersönlichen Verben ansieht, während es 
bei intransitiven überhaupt vorkommt, z. B. mulun ,er kommt'. 6. In 
bzopon mag b- eher als Dativ denn als Nominativ zu fassen sein. Es 
stimmt dazu das u- von uzopinunan ,(sie) sagten' S. 104, 26; nur muss 
dann auch das Substantiv im Dativ stehen, also hekimepe ,die Arzte' 
in hekimepes verbessert werden. 8. Auch anäyoro ,ich spie' (im Wtb. 

£ -o 
-o v 

E-e 

E => 

fD O) 

- "I nv , li7ö , h ,( Original frorm 

| S Digmzeo Dy ^uu^lL CORNELL UNIVERSITY 

C _Q 

ü Q_ 






cn 



o O 



(T3 



2 5 



F P. 



u 

O <L> 

CT 



Etüde sur la langue laze. 401 

durfte es nicht so eingereiht werden, da a keinesfalls stammhaft ist) 
wird unpersönlich sein, da man dafür auch im Georgischen sagt: 
mant'xia, von nt'yfiwa oder V%ewa ,ausgiessen' (also eig. ,es ergoss 
sich mir'), wie ja auch laf. ont%oru (das gewiss dasselbe Verb ist wie 
and%oro) ,begiessen' bedeutet (arm. t'k'anel ,speien', ,spucken' kann 
also nichts damit zu tun haben). Es wäre aber entweder emd%oro 
oder die Bed. ,er spie' zu erwarten. 15. gemiltu ,ich glitt aus' (,se 
glisser', wie 14 ,se plaire', 16 ,se trembler' haben ihr ,se' zu verlieren; 
17 ist statt ,se souiller' zu lesen: ,suer') wird wohl ein uneigentlich 
unpersönliches Verb sein; nämlich es wird daneben das Wort für ,Fuss', 
stehen, wie im Georgischen: pe%i gamisxlta. Übrigens finde ich im 
Wtb. dies Wort weder unter It noch sonstwo. 19. Mit der Bedeutung 
,se gratter' werden verzeichnet mat§aminen 1. P. Praes. und moit$amini 
1. P. Perf.; sie passt nur für die letztere Form, die aber nicht un- 
persönlich ist (vgl. mingr. wmuhu, qecaTb Starö.), die erstere bedeutet 
offenbar ,es juckt mich'. 20. gwabinen ,ich erinnere mich' zu gobi- 
nap'a enthält kein Zeichen für die 1. P. als Dativ; go-wa- würde 
die 1. P. als Subjekt ausdrücken, aber dazu passt wieder die Endung 
nicht. 21. Zu ,etre cuit' wird als 1. P. igiben gesetzt; das kann nur 
eine 3. P. des Passivs sein. 22. Bei knolu ,ich gähnte' ist wohl das 
Präfix der 1. P. überhört worden : mknolu oder maknolu = georg. 
mamtfk'nara (persönlich: warnt 'k'nare] das Verb mit dem offenbar un- 
organischen m- ist dasselbe wie das lafische; die mingrelische, wahr- 
scheinlich vermittelnde Form steht mir nicht zur Verfügung). 26. Das- 
selbe muss bei %oropu ,ich liebte' der Fall sein, wenn es nicht etwa 
so viel ist wie ,er liebte' (oder ,verliebte sich'). Denn das -op- erregt 
mir Bedenken. Rosen verzeichnet als Infinitiv oropu (oropa ,Liebe' in 
Trapezunt) = mingr. qoropa, georg. qwareba, -oba] dies -op- y -op*-, 
-ob-, -eh- ist aber ein Zeichen des transitiven Verbs: ,lieben'; während 
,geliebt werden' durch den reinen Stamm ausgedrückt wird: georg. 



V ct 



w i 

fN CO 

O u 






o 2 



F P. 



'ct 



miqwars, mingr. miqorsj ,ich liebe ihn'. Diesen Formen als gleich- 
wertig erscheint mir ma porum bei Rosen; der Verf. schreibt das 
mit Unrecht in einem Wort: ma ist Vollpronomen und porum steht 
für *pqorum (s. oben S. 398 f.). Wegen des -m für -n vergleiche man 

E-e 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



402 M. H. Adjarian. 

bei Rosen: komükum und memaSonem. 21.komaziru bedeutet nicht, 
wie auch Wtb. S. 66 angegeben wird: je t'ai vu(e)' (das wäre koma- 
ziri), sondern je Pai vu(e)'. Es handelt sich hier, wie bei 29. duma- 
Siru ,ich habe abgenutzt', um eine eigene Zeitform, ähnlich dem 
georg. Prät. in und iv; das Prät. n (Perf. oder Aor.) lautet dazu 
kobziri, dobsiri. 31. komiSuls (so auch im Wtb.) ,ich erinnere mich'; 
Erckert, dem die Form entnommen ist, schreibt komSuls. Bemerkens- 
wert ist die Endung -s, die von den Verben hier sonst nur noch 

kl- 
eines aufweist: bSkirons ,mich hungert' (Erckert hat mSk'ironi) = 

i^ 

georg. mSiiSj msian, mHwa ; doch heisst es z. B. auch myomins ,mich 

dürstet', gontanups ,es blitzt'. 32. galemale ,ich habe aufgelöst' ist 

im Wtb. unter mal gestellt; aber ma- ist ja ,mir', und der Stamm 

le, ohne Präsens- noch Perfektendung, der gleiche wie in georg. 

lewa ,erschöpfen', ,schwächen' u. s. w. Suri emale ,mon äme s'en 

va' (nicht wie S. 38 ,Päme . .') würde georgisch sein suli ay-me- 

lewa] vgl. bei TSübinow: guli melewa, cepdt^e y mchr U3Hbieaemz. 

S. 91, 3 miaminu ,mich dürstete' wird in mia-min- zerlegt; mia- 

figuriert S. 84 als besonderes Präfix, und im Wtb. ist min als 

£ g 

Stamm eingetragen. Das ist ganz unrichtig. Zu georg. ymoba ,ver- 
trocknen' (3. P. Perf. yma) haben wir %meli, mingr. laf. %omola oder 
ypmula ,trocken'; dazu weiter laf. oypminu ,vertrocknen', und nun 
unzweifelhaft auch omini ,Durst', (mingr. qumeni bei Erckert); denn 
laf. m%omins ist ,mich dürstet' (so bei Erckert; der Verf. hat diese 
wichtige Form nicht aufgenommen). Miaminu steht für *mi%ominu. 
In mia§uri ,ich roch' muss das mia- anders erklärt werden (da 
äur- allerdings der Stamm ist; vgl. georg. suneba ,riechen'); es 
scheint mir dass das Zeichen der 1. P. als Subjekt zwischen i und 
a ausgefallen ist: mi-wa-, aber statt rai- erwarteten wir mo- (georg. 
mow8une). 

Es ist befremdlich dass der Verf. gewisse sehr wichtige Ver- 
hältnisse der lafischen Konjugation, auf welche allerdings von Seiten 



Q- 



cn 



<=> o 



(T3 



2 5 



«4- ~° 

O <L> 



'i/i öi 

der andern kharthwelischen Sprachen kein Licht fällt, nicht erkannt 



c (5 



hat. Ich meine die mehrfache Rolle welche der Konj. Präs. (§86) 
spielt. Der Verf. sagt § 72, indem er Rosen folgt, dass in der Mund- 

.E "o 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by LjOOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



Etüde sür la langue laze. 403 

art von Atina das Präsens, d. h. der Indikativ die Endungen -dre, 
-dre, -asere, -aUre, -atdre, -anene habe. Es wäre zu sagen gewesen 
dass um den Indikativ zu bilden, an den Konjunktiv ere, nach Vokal 
re angesetzt wird, welches die Bedeutung ,ist' hat (so viel hatte 
schon Rosen, Über das Mingrelische u. s. w. S. 52 gesehen) und im 
Lafischen sonst als ren, reni, aber im Mingrelischen als re, im Swa- 
nischen und Altgeorgischen als ari erscheint. In der 3. P. PI. hat 
sich das r von -ere an das vorausgehende n angeglichen; bei den 
unpersönlichen Verben findet sich noch -anere (§ 105 f.). 1 Ich glaube 
hier den Einfluss des Griechischen zu erkennen. Der einfache Kon- 
junktiv ist im Griechischen mit dem Indikativ zusammengefallen und 
wird nun durch einen Zusatz (vi) von diesem geschieden; im Lafischen 
ist das Umgekehrte geschehen. Direkt nachgebildet aber ist das 
lafische Futur, wenigstens das in der Mundart von Batum übliche, 
dem griechischen: bdgdra-minon ,ich werde schreiben', d^aras-unon 
,er wird schreiben', rv? OeXw YP ^? 6 ^ ^eXet YP^fl- I* 1 dem zweiten Teil 
erblickt der Verf. § 82 richtig das Verb ,wollen'; aber wie kann 
er dann d £ ar-a~sunon u. s. w. abteilen, da doch die 3. P. dieses 
Verbs unon lautet (§ 104)? Dass der erste Teil der Konjunktiv 
ist, entgeht ihm auch hier; er bezeichnet ihn als den um a erwei- 
terten Stamm. Noch deutlicher zeigt sich der Einfluss des Grie- 
chischen im umschriebenen Perfekt und Plusquamperfekt des Lafi- 
schen (§ 131): dzarali miyun ,ich habe geschrieben', d^arali miyutu 
,ich hatte geschrieben' <v eyo) YpoqjLjjtivo, elyjx ^pa^evo. Dieselbe Aus- 
drucksweise ist neuerdings im Georgischen sehr aufgekommen und 
stammt wahrscheinlich daher. 

Ich habe bei weitem nicht alles Unverständliche und Wider- 
spruchsvolle berührt was mir in den mitgeteilten Sprachformen und 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



(T3 



2 5 



F P. 



u 

«4- ~° 

° N 

1 Doch treten bei diesen Verben die Formen von ,sein* auch unmittelbar an 
den Stamm an, und zwar im Sing, -on (min-on\ -en (makizkan-en), -n (komiSku-n), 
von onu oder ren ,er ist', im Plur. -onan (min-onan) y -ere (makizkan-ere), -ran (ko- 
mi$ku-ran), von oreran, renan ,sie sind'. — In den Liedern von Atina treten an 
den Konjunktiv im Sing, die Endungen ~en, -eren an, z. B. güwasasen, dotanaseren. 
Über diese Formen erfahren wir aus Wtb. und Gramm, nicht das Nötige. 
Wiener Zeitschr. f. d. Kunde d. Morgenl. XVI. Bd. 27 

E-e 

E => 

to _c 
in +j 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



404 M. H. Adjarian. Etüde sur la langub laze. 

deren Bedeutungen aufgestossen ist. Vieles ist ja offenbar verhört 
oder verschrieben, aber Vieles auch lässt sich eben aus dem was 
bisher vorliegt, noch nicht erklären, und die Grenze zwischen beidem 
ist gar zu schwer zu ziehen. Ich verzichte darauf die kleineren Ver- 
sehen oder Druckfehler die nicht schon gelegentlich bemerkt worden 
sind, nachzutragen, mit Ausnahme der in den Gesprächen enthaltenen, 
deren Berichtigung nützlich sein dürfte (ich behalte hier die Schrei- 
bung des Verf.s bei). Lies S. 102, 14 kodoiguri statt kodoviguri. 
16 Mu mlcitxub statt Murrt kitxub. 8 v. u. oti otx xut statt oti xuL 
103, 6 emus statt emus. 3 v. u.: vidamintu statt midavintu (dieser 
Fehler auch § 28; das Richtige S. 95). 103, 12 v. u. 104, 18 so nulu* 
statt son idu? 104, 7 gamacasunon statt gamabcasunon (und ebenso 
S. 39 metamuH statt meb(amusi). 1 2 v. u. ad miora (so S. 5, 3) statt 
acim £ora. 105, 17 v. u. mogiga statt mogiga, 1 v. u. xopuma minon 
(der Infinitiv, nicht der Konj. neben , wollen', wenn dies seinen eigent- 
lichen Sinn hat; ebenso 106, 5) statt xopumaninon. 102, 17 muss die 
Negation vor momcab fehlen; denn mo steht als solche doch nur 
beim Imperativ, und mo ist hier Präposition (vgl. momüi ,gib' S. 105). 
Manchmal sollte sich die Übersetzung enger an den Text anschmiegen: 
so ist 103, 4 v. 0. und 1 v. u. ar ,une fois' (wie das georg. ert'i) nicht 
wiedergegeben; 103, 4 v. u. das -m- ,mir* von momkitxi nicht; 104, 24 
war ma gavakni (georg. me gawigone) zu übersetzen mit j'ai entendu 
(dire)' statt mit ,on m'a dit'; 105, 17 v. u. und 8 v. u. fehlt das ,vous* 



CÜ 



t! öi 



w l 

fN CO 
f\l ^ 
, O) 

° £ 

von mogiga 



Wir danken dem Verf. für das reiche Mahl das er uns auf- 
getischt hat; aber wir stehen doch recht hungrig auf. 



2 5 



iE ^ 

H. SCHUCHARDT. 



F p. 



1 Auch in wisiminua, wsiminu ,hö*ren' und wislolama ,werfen* zu den Stämmen 
simin und stol seheint sich das wi- der 1. P. verirrt zu haben; aber die Wiederholung 

eines solchen Vorgangs stimmt mich allerdings bedenklich. 

a> ? 
> <u 

=> O 

— . 

£ -o 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

_ 

ü Q_ 



Original fronn 



Kalhana's Rajatarangini. 405 

M. A. Stein, Kalkana' 8 Itäjatarahgini. A Chronicle of the Kings 
of Kasmlr. Translated, with an Introduction, Commentary, and 
Appendices, by — . With 3 maps. 2 vols. Westminster: Archibald 

CONSTABLE & Co. 1900, 4°. 

,Mit deiner Idee, dass die Inder keine historische Literatur 
haben, stehst du auf einem veralteten Standpunkt/ schrieb der un- 
vergessliche Bühler schon im Jahre 1877 an seinen Freund Nöl- 
deke, x und wenige Monate vor seinem jähen Ende sprach er noch 
Ad. Kaegi gegenüber begeistert davon, wie er in dem der Ge- 
schichte Indiens gewidmeten Teil des , Grundrisses' die allgemeine 
Rede, es habe den Indern der historische Sinn gemangelt, ein für 
allemal widerlegen werde. 2 Auch W. Geiger 3 hat unlängst mit 
Recht darauf hingewiesen, dass schon die zahlreichen Inschriften, 
die man in Indien gefunden hat, Zeugnis dafür ablegen, dass den 
Indern der historische Sinn keineswegs abgeht. Dasselbe bezeugen 
ja auch die Chroniken und Biographien der Buddhisten und Jainas, 
die ihrer Kirchengeschichte und der Geschichte ihrer Heiligen grosse 
Aufmerksamkeit zuwandten. Richtig ist nur, dass die indische Ge- 
schichtschreibung sich niemals ganz von den Fesseln der Dichtung 
frei gemacht hat, ja dass sie geradezu bewusst als zur Poesie — 
zum Kävya — gehörig auftritt. Das Studium der Geschichte ist 
nie zu einem Sästra geworden; die Geschichte wurde nie, wie 
so viele andere Wissenschaften, in Schulen gelehrt, sondern der 
Kavi, der Dichter, war es, der in kunstvollen Versen das Leben 
und die Thaten eines Herrschers — gewöhnlich des Fürsten, dessen 
Gunst er genoss — besang. Die Werke dieser Dichter, die Caritas, 
haben natürlich einen panegyrischen Charakter, und die Regeln 
des Alamkäraäästra sind für Dichter wie Bäna oder Bilhana von 
grösserer Wichtigkeit als historische Wahrheit. Dass sie aber den- 



CÜ 



ö. 2> 



w i 

fN CO 

f\l ^ 

, O) 

O o 

c v> 

o 2 



(T3 



* 3 

F P. 



u 

«4- ~° 



-M ±1 

1 J. Jolly, Georg Bühler: Grundriss i, 1 A, S. 13. 

7 7 7 

2 Kaegi in dem Nekrolog auf Bühler (Neue Zürcher Zeitung 1898, s. Ind. 
Ant. xxvii, 362). 

8 Dlpavamsa und Mahävamsa, die beiden Chroniken der Insel Ceylon. Er- 
langen und Leipzig 1901, S. 1 fg. 

27* 

o "c 

E => 

to _c 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



406 M. A. Stein. 

noch auch als Geschichtsquellen in Betracht kommen, hat Bühler 
zuerst erkannt. 1 

Hoch über diesen Caritas steht aber das Werk des Ka&mlre 
Dichters Kalhana, die Räjataraftgini, sowohl als Geschichtswerk, 
wie auch als literarisches Produkt, und ihr gebührt ohne Zweifel 
eine hervorragende Stelle in der Geschichte der indischen Literatur. 
Obwohl aber dieses Werk längst bekannt war, ist es doch erst durch 
die Arbeiten Steins möglich geworden, dasselbe in seiner literarischen 
und historischen Bedeutung vollauf zu würdigen. Erst Stein hat uns 
einen philologisch völlig zuverlässigen Text des Werkes gegeben — 
in seiner Bombay 1892 erschienenen Ausgabe — , und er ist es 
wieder, der uns durch die vorliegende Übersetzung das Verständnis 
des Werkes aufs beste vermittelt und durch die noch wertvolleren 
Beigaben — Einleitung, Noten und Appendices — die Bedeutung 
desselben für die Geschichte, Geographie und Ethnographie Kasmirs 
ins rechte Licht gerückt hat. 

In einer 145 Seiten starken Einleitung stellt Stein nach einigen 
allgemeinen Bemerkungen über die historische Literatur der Inder 
zunächst die biographischen Daten über Kalhana zusammen, zeigt, 
mit welchen Literaturwerken er bekannt war, und schildert uns das 
Milieu und die Zeitumstände, unter denen er lebte. Er gibt uns 
sodann eine überaus sachliche und verständige Würdigung der Rä- 
jataraftginl als Dichtung und als Geschichtswerk und handelt ein- 
gehend über die Textüberlieferung. Darauf folgt eine Darstellung 
von Kalhanas Chronologie und eine kritische Analyse der Räjata- 
raftginl als Geschichtsquelle. 

Kalharia nennt sich den Sohn des grossen Kasmir'schen Mi- 
nisters Canpaka, und da er die Räjataraögini zwischen 1148 und 
1150 geschrieben hat, ist es nicht nur wahrscheinlich, sondern — 
wie Stein nachweist — nahezu mit Sicherheit anzunehmen, dass 



ti öi 



w i 

fN CO 

f\l ^ 

, O) 

o y 

O o 

c v> 

o E 



(T3 



2 5 



F P. 



u 

«4- ~° 



CT 



dies derselbe Canpaka ist, der als Minister des Königs Harsa 



> v 

(1089 — 1101) von Kalhana wiederholt genannt wird. Canpaka und 

c e> 

1 S. die Einleitung zur Ausgabe des Vikramänkadevacarita (Bombay 1875), 

p. 3 ff. 

.E -ö 
-ö v 

E-e 

E => 

fD O) 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original fronn 



Kalhana's Rajatarangini. 407 

Leute aus seinem Haushalt waren es ohne Zweifel, welche als 
Augenzeugen dem Dichter über die Ereignisse unter König Harsa 
und namentlich über das tragische Ende dieses indischen Nero be- 
richtet haben. Dass Kalhana von Geburt ein Brahmane war, und 
dass er zur Sekte der Saivas gehörte, geht aus der Art und Weise 
hervor, wie er in seinem Werk von den Brahmanen spricht und 
wie er einen König um den anderen wegen seiner sivaitischen Ge- 
sinnung preist. Wenn Kalhana von einem König sagt, dass er ein 
,Siva -Verehrer' war, so gebraucht er den Ausdruck oft genau so, 
wie wenn ein Engländer einen guten und braven Menschen als 

, Christen' bezeichnet. Sehr treffend charakterisiert Stein das Ver- 
erb 

hältnis Kalhana's zum Buddhismus (Introd. p. 8 sq.). So zweifellos es 
ist, dass Kalhana selbst ein Saiva war, so hatte er doch, wie aus Zahl- 
reichen Stellen der Räjatarafigini hervorgeht, grosse Sympathien für 
die Buddhisten: er preist nicht nur Asoka und andere Könige wegen 
ihrer Stiftungen von Vihäras und Stüpas, sondern zeigt auch eine 
intime Bekanntschaft mit buddhistischen Lehren und buddhistischer 

Terminologie und spricht mit unverhohlener Ehrfurcht und Sym- 
£ g 

pathie von ,Jinas' und Bodhisattvas. Das hindert freilich nicht, dass 

er an einer Stelle (Räjat. i, 184) von der , Kalamität der Bhiksus' 

in ^ 

spricht, welcher der zweite Candradeva ein Ende gemacht, so wie 
der erste Candradeva die ,Yaksa-Kalamität' beseitigt hatte. Wenn 
wir auch annehmen dürfen, dass er an dieser Stelle etwas zu skla- 
visch einer brahmanischen Vorlage gefolgt ist, und dass der Witz 
von yaksaviplava und bhiksuviplava den zu Sarkasmen sehr 
hinneigenden Kalhana besonders reizte, so beweisen die Worte doch, 
dass er fern davon war, sich geradezu zum Buddhismus zu be- 
kennen. Kalhana steht dem Buddhismus genau so gegenüber, wie 
etwa bei uns ein gebildeter Katholik dem Protestantismus. 

Und dass Kalhana ein hochgebildeter und unabhängig den- 



w i 

fN CO 

O u 



O o 

c v> 
o 2 



(T3 



2 5 



F P. 



u 

«4- ~° 

O <L> 

*S 

kender Mann war, darüber kann kein Zweifel sein. Als Sohn eines 

Brahmanen und Ministers hatte er jedenfalls eine gründliche brah- 

CO 



manische Bildung genossen. Er ist sehr belesen, vor Allem ein aus- 
gezeichneter Kenner des Mahäbhärata, das er oft zitiert. Von an- 

.E -ö 
-ö v 



fD O) 
in 4-/ 

1 i Digilized by ^.OOglC CORNELL UNIVERSITY 

ü Q_ 



Original from 



408 M. A. Stein. 

deren Werken hat er, wie Stein nachweist, Bilhana's Vikramäüka- 
devacarita und Bäna's Harsacarita eingehend studiert. Zitate aus 
Varähamihira's Brhatsaiphitä beweisen seine Bekanntschaft mit Astro- 
nomie; und dass er in seine Erzählung gerne literargeschichtliche 
Daten einflicht, bekundet sein Interesse für Literatur. Unter an- 
deren erwähnt er auch MaAkha, den Bruder des Alaipkära (Räjat. 
viii, 3354). Dies ist der Verfasser des Srlkanthacarita, in welchem, 
wie Stein (Introd. p. 12 ff.) in höchst scharfsinniger Weise nachweist, 
auch Kalhana unter dem Namen Kalyäna von Maftkha als zeit- 
genössischer Dichter gerühmt wird. Kalhaija ist eine Apabhraipfia- 
form für das Sanskrit Kalyäna. 

Kalhaija nennt sich selbst einen Kavi und, ebenso wie die 
oben erwähnten Caritas, ist auch die Räjatarafigini zunächst ein 
Kävya, ein Kunstgedicht. Aber ungemein vorteilhaft sticht Kal- 
hana von dem gewöhnlichen Kavi oder Kunstdichter ab, indem er 
in der Darstellung von Charakteren nicht blosse Typen — weisse 
Helden und schwarze Schurken — , sondern ungemein realistisch 
dem Leben nachgezeichnete individuelle Charaktere lebendig vor uns 
hinzustellen weiss. Ich erinn